SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023775 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023775
Domain Number 1 Region: 280-382
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000531
Family I set domains 0.028
Further Details:      
 
Domain Number 2 Region: 79-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000673
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 174-271
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000924
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023775   Gene: ENSMODG00000019049   Transcript: ENSMODT00000024198
Sequence length 384
Comment pep:novel chromosome:BROADO5:5:15531722:15586634:-1 gene:ENSMODG00000019049 transcript:ENSMODT00000024198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRFEGPRLVPPLLLLLLLLLLLETLSTAASQASTKSKRPKEPGENKIKPANKRGKLPPT
PGKDRDSVASVPKTPSIMMQVMEKGRFQKPAATLSLTAGQTLELRCKGNNIKWRYPEYLD
TFKDSRLSVKQHDRYGQLVLENATAADTGEYSCWLQVCSGYVCRKDDTKTGATYIFFTEK
GELFVPSPSYFGVVYLNPDREAIVPCRVTVPSAKVTLHREFPAKEIQSNGSITYDLKRGF
VYLHPQPDHQGVVYCRAEAHGAPQISIKYQLLYVEVPSGPPSTTIMASSNRVNGGADVTV
FCTVLGEPDVEVEFRWIYPGQKDGRLVTIQDTWRLLSRGLGHTTRLSQSALVLQDFRTVD
AGYYMCTAQNARGQTTVATTVQLS
Download sequence
Identical sequences F7AYD0
ENSMODP00000023775 ENSMODP00000023775 XP_007495677.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]