SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023853 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023853
Domain Number 1 Region: 247-326
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000962
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 69-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000596
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 162-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000108
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 1-73
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000222
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023853   Gene: ENSMODG00000029169   Transcript: ENSMODT00000024277
Sequence length 355
Comment pep:novel chromosome:BROADO5:Un:48753158:48773430:1 gene:ENSMODG00000029169 transcript:ENSMODT00000024277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCNAMGQIHAYRWFINGLAPVGSRIQLSPDKRILTLRRLTRRENKGPYVCEIENPLFRN
RSDPFPLNVTYGPDIATIVRSAGVYPTGVNITLSCVADSNPPAQFTWLQNGQSVSNSAIF
SVISSLNHAGTYTCIASNSFTGLTHTATKNIIIYAPLSKPTIITSNNTAVETKDFSMTCN
ATGQIHAYRWFINGLAPGGNRIQLSPDKRTLTIRSLRRMENKGPYVCEIENLLFRERSNP
FTLNVTYGPDNATIVHSANEYPTGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSIIA
SLSDAGTYTCTASNSFTGLTRTATKNIIIYGEYLDWAPNFVWGSLFPWHDRNRQK
Download sequence
Identical sequences M9MMI0
ENSMODP00000023853 ENSMODP00000023853 XP_016282838.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]