SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023975 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023975
Domain Number 1 Region: 179-268
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000128
Family Fibronectin type III 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023975
Domain Number - Region: 23-103
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00405
Family Apolipoprotein 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023975   Gene: ENSMODG00000019203   Transcript: ENSMODT00000024399
Sequence length 444
Comment pep:novel chromosome:BROADO5:2:503824820:503866563:1 gene:ENSMODG00000019203 transcript:ENSMODT00000024399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRMEPEPNPEVLLQEARESIDAAQSYRRELGQRLQGLQAARRQIKDSASQTRDVLRQH
FNDLKGTLRKLLDERLVSLLQEVDTIEQETIKPLDDCQKLIEHGVSTAEDLVREGEIAIV
GGVGEKNEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSILTIVKDQIFNHGTVA
SRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKSTSNHFEDVYVGSETEFIVLH
IDPNVDYQFRVCARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFEGYSLSSRRNIALRNDS
QATGVLYSSAPTYFCGQTLTFRVETVGQPDKRDSIGVCVEKQNGYDSLQRDQAVCIGTNG
AVFVNGKEMTNQLPAVTSGSTVTFDMEAVTLVTTANNDAGNFKLRVTISSNNREVVFDWL
LDQAYVSLYFGCSFFYPGWKVLVF
Download sequence
Identical sequences F6ZIV3
XP_001368350.1.35504 ENSMODP00000023975 ENSMODP00000023975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]