SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024110 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024110
Domain Number 1 Region: 745-805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000089
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 678-740
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 333-391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 220-329
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000406
Family Spermadhesin, CUB domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024110   Gene: ENSMODG00000019317   Transcript: ENSMODT00000024537
Sequence length 903
Comment pep:novel chromosome:BROADO5:2:506861603:506897320:-1 gene:ENSMODG00000019317 transcript:ENSMODT00000024537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPEAQNLGSAETDGEPTVAPTPEQPEGGVHFVSTAPTLKLLNHHPLLEEFLQDALEKED
ELKPGPFLGRGPAPFQPDAPTLFIPSPLAHLAHRDDRPIFTNPTPAMAPGPPYSLGRDGA
QSPEPAWPTLPVTAAPPPGPGVMAPSLAQADMPVTVPPRSTWMVTHDVSMDLAQPWVPDV
VPPQAREPDSLEMTGALTTGTYWGQAGATSIICTTCSPPPCSWNFTRPQGSLNSPEGPSS
AEDSSLDCFYYITVYPGYGVEIKVQNISLLEGETVTVEGMGGPEPLPLANQSFLLQGQVI
RSPTNQVAMRFQSLLPPTGPGTFHFRYQAYLLSCSFPQRPAYGDVAVTSLHPGGKARFHC
TTGYQLQGARVITCLNATRPFWDSREPICIGECRSKAFGLFRLGTSSLPSRPFPAIPNLL
TYDISPGEEQRMWPLGPFLDAGSGLRLINRVPLVYSLSLCRNVKPALTFSQQVYLVVKMG
LHSLTCIPTLDKSLPVPSEFVHPLISCLAVIIRVPMNVMLDGINVSQTSSHLLLTPCGEG
SRARTLNRPISRLRRRAGRPFQGWASWWVHGLVPDFTVSRESWDRLLSYWGGNLRFPLGF
PSPPLHLASPPSKMVQQMQKGKNVKEQSQSQGICTNTNSREWPGSRASWSRAGLGRIHMQ
AMPILGFSSSCPLQSPVTSCHDPGDVEHSRRLISSPKFPVGATVQYICDKGYMLTGSAIL
SCHDRQAGSPKWSDRAPKCLPEQYKPCHGPGTPENGARSPEKRLYPPGATLHFSCAPGYV
LQGEASIKCVPGHPSQWSDHPPTCKAASLNEFYSGRSLDVAKAPTATNSLDATHVAAAIF
LPLAAMALLMGGIYLYFSRVQGKSPLQLPLAQPRPYDHITVENAFDNPTYETGSLSFAGD
EGI
Download sequence
Identical sequences F6XTE7
ENSMODP00000024110 13616.ENSMODP00000024110 ENSMODP00000024110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]