SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024296 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024296
Domain Number 1 Region: 15-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-69
Family Eukaryotic proteases 0.000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024296   Gene: ENSMODG00000019475   Transcript: ENSMODT00000024726
Sequence length 261
Comment pep:novel chromosome:BROADO5:3:17478948:17488832:1 gene:ENSMODG00000019475 transcript:ENSMODT00000024726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIPLCFASLLSGFTFLLLIPGDSCVDIIGGDEVFPHSRPYMVLIHTGRDLCGGALITEN
WVVTAAHCNTKASSKVILGAHSSKKKEPEQQIMTIKQHIPYPCYVPSTKSGDLKLLQLTK
KAKITKAVQTLKLPQNADDVKPGTSCKVAGWGQTNNRDKKLPEALREVNVTVIDRKTCND
QKHYNFNPIIGLNMICAGNLKGGKDSCYGDSGGPLICKGNFVGITSFGLPGKCGVPQGPG
VYTRLSKEHLNWIKNTIKGVV
Download sequence
Identical sequences F6RB99
ENSMODP00000024296 XP_001380969.2.35504 ENSMODP00000024296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]