SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024345 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024345
Domain Number 1 Region: 31-505
Classification Level Classification E-value
Superfamily Sema domain 1.7e-157
Family Sema domain 0.00000000312
Further Details:      
 
Domain Number 2 Region: 507-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000279
Family Plexin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024345
Domain Number - Region: 568-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00583
Family C1 set domains (antibody constant domain-like) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024345   Gene: ENSMODG00000019513   Transcript: ENSMODT00000024775
Sequence length 818
Comment pep:novel chromosome:BROADO5:1:121743480:121782581:-1 gene:ENSMODG00000019513 transcript:ENSMODT00000024775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGSRLAQLGALFLLLRPKPLTEAIVPRVSLPYDSQERTVRRFEAEGIANYTALLLSKD
GKTLFVGAREALFALTSTSSFLPGGHYQQLLWSADPEKKHQCVFKGKDSQRDCHNYIKLL
QPLNSTHLYTCGTAAFSPVCAYINIQNFSLEQDGAGNIVLEDGKGRCPFDPEYKSTAILV
DGKLYAGTVSNFQGNEPTISQSQGNRLTLKTENSLNWLQDPAFVSSAYIPESLDNPRGDD
DKIYFFFSETGKEFDFFENTIVSRIARVCKGDLGGERVLQRRWTSFLKAQLLCSRPSDGF
PFNVLQDVFVLSPGPKDWQDTLFYGVFTSQWHQGAAGGSAICVFTMQDVESAFSGLYKEV
NRETQQWYTVMDSPTPRPGACITNSAREKKINSSLQLPDRVLNFLKDHFLMDRQVRSSPL
LLQPRARYQRLSVHRAAGLHRSYDVLFLGTSDGRLHKAVHSRQRMHIIEEIRLFPSDHPV
QNLLLDPQRGLLYASSYSAVVQVSVANCSVYTSCGECILSRDPYCAWSGTGCRDVRHYQP
DLASQPWVQDIEDADTGRLCNSSAFGLLPPGFSDKTPCKQVHFQPNTVNTLTCRLLSNLA
SRRWLHNGAPVNHSASYRVLPSGDLLLVGSQDGLGSFQCWSLEEGFQQLVASYCVEATEG
AADGEKGSIIPLIINTSRVSSPANGKAALAPYKTYWNEFLLMCGLFGFAVVLLALFFLYR
HRDGMKLFLKKGECASVHPRTRPVMLPSENRSLNGGGPPSALPDHKGYQALADSSPGLRA
FTESEKRPLSVQDSFVEVSPTCPRPRVRLGSEIRDSVV
Download sequence
Identical sequences F6VD85
ENSMODP00000024345 XP_007479384.1.35504 XP_007479385.1.35504 ENSMODP00000024345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]