SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024346 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024346
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-23
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 344-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-16
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 113-219
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000018
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024346   Gene: ENSMODG00000019515   Transcript: ENSMODT00000024776
Sequence length 734
Comment pep:novel chromosome:BROADO5:3:18337333:18386250:1 gene:ENSMODG00000019515 transcript:ENSMODT00000024776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMLLWALFLLFGNFCLADLPKKPKNISCVFYLQKNFTCTWRPEKEVYPTVYNVTRIYVSG
RKIDYCTSQNRTSCSFCYPNLTYPDNYSIQVEAKNAFGQSKSEVTYWSLQNIVKAEPPEI
QTVKPIPGVKHMLQVEWKKPERLPSFGLCECRLKYRLVNSTKWVSIIIRMEPVSQRMTYE
MPYNLTGLLALRQYAVSMQCRMVSSEFWSIWSEERIGTTEGLGKRIFSPNSSLDFWRVLG
PAQPDGKRIVQVLCKEPRADPRIRKAIEYEIRYFPESENSSKETIITADRQSELHLGSGA
YLVSVLYFTSDGASPEATLRIPAVHEKPLQCIEGMQLHHFQDRLMLKWNSSAAEVDRWVI
EWYPDEENKTLERSWEYISQTRTWTGRADNFKPFQCYNISVYPVEGMEVGAPHSVQAYFT
EGIPEEGPRAKAQNISSHSATIKWEEISKAQRKGFIRNYTVFYKSEGGKEFAQIVNSSVL
QCQLESLERNTQYTVTVMANTLAGGKNGTNFNFKTLSFSILEMVLFISFTGAGLLFLAIL
LMVCSLTKAKLKRLVCPEIPNPAKSNVVLWHGGSLQSKMHLGEVQFQGKTKAIDERIPKP
FLSSSGDLIDKLVVDFENFLDKTEVQRVELMKMPENVSSGEEKYVDTPYSRCNPSGEVFQ
APSSALISLGGTQEQSSGRPEEEVKDRLFQSPSSSEALELEQEEARLNPYLKNSVTTREF
LTSEKFSDPIKKTE
Download sequence
Identical sequences F6VD74
ENSMODP00000024346 13616.ENSMODP00000024346 ENSMODP00000024346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]