SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024349 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024349
Domain Number 1 Region: 26-125
Classification Level Classification E-value
Superfamily Fibronectin type III 9.44e-42
Family Fibronectin type III 0.0000266
Further Details:      
 
Domain Number 2 Region: 125-222
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-25
Family Fibronectin type III 0.0000317
Further Details:      
 
Domain Number 3 Region: 224-319
Classification Level Classification E-value
Superfamily Fibronectin type III 6.69e-21
Family Fibronectin type III 0.0000114
Further Details:      
 
Domain Number 4 Region: 437-606
Classification Level Classification E-value
Superfamily Fibronectin type III 2.05e-19
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 346-416
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000104
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024349   Gene: ENSMODG00000019517   Transcript: ENSMODT00000024779
Sequence length 923
Comment pep:novel chromosome:BROADO5:3:18412119:18464806:-1 gene:ENSMODG00000019517 transcript:ENSMODT00000024779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLTLWTWKVQALLIFITFDSVQGGILKPCGHIIPESPIITPNTKFTAICILKEECVNDQ
HLNASHIFWKIKNTYIPKEQYTVINRTAASVTLEDVSSLGSLLTCNILLYGQIEQTIYGI
QMQIGWLPEKPKNLSCVVNGQTNMKCQWDPGKETHLDTTYVLKSEWPTRQLPDCIPPPGV
NDSCTIDMVVVFVNMDVWVVASNALGNVSSDRINFDPIDYVKLLPPHNLSVSNSKELSSI
LKVSWANPVNKPFDGLKYNIRYREKEASNWTLIPPEDTATTRNSFTVQDLKPFTEYVFSI
QCMNIEGKGFWSNWSAEASGVTYEAKPSNASSFWYEIIPSQGHGYRLVLLKWKPLTRSQA
NGRILDYEVTLKGGKTSHLPIYTNDTKLTVNVTNDPYVVSLKARNIVGSSDPSTLTIPGC
DFKAAHPVTNLKAFPKDNALWVEWTPPNEPVNKYILEWCIFSDNLPCIRDWQQETSAVHQ
TYLQGKFLESKCYLITVIPVYDDGPGSPQSVQAYLKQAPPSKGPSVRTKKVGKNEAVLVW
DHLSVDDQNGFIRNYTIFYKTSSGNETKAVHVNSSHREYTLSPLNSDTLYMVRMAAYTDE
GGKEGPEFTFTTSKFAQGEIEAIVVPVCLAFLLTTLLGVLLCFNKLDLIKKHIWPNVPDP
SKSHIAQWSPHTPPRHNLHPKEQMYPEGTFTDTDVSVVEIEANVKKPSPEDLKSLDLFKK
DKVIAEGHSSGIGGSSCMSSSRPSISSNDESESGQNTSSTVQYSTVVHSGYRHQVPSVQV
FSRSESTQPLLDSEERQEDLQIVEDGGRGDGAAPRQPYFKQTCGRDDAAPELPRFERSKQ
ASPGSEEDVVRLDPQQGSDARSRSSGLGPMRDSEAVKAADGLGPGPEGPSPRSETAGLEA
AADENMPKSYLPQTVRRGGYVPQ
Download sequence
Identical sequences F6VD48
XP_001365726.2.35504 XP_007486391.1.35504 ENSMODP00000024349 ENSMODP00000024349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]