SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024423 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024423
Domain Number 1 Region: 163-271
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-38
Family Link domain 0.0023
Further Details:      
 
Domain Number 2 Region: 275-360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-30
Family Link domain 0.00082
Further Details:      
 
Domain Number 3 Region: 50-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000179
Family V set domains (antibody variable domain-like) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024423   Gene: ENSMODG00000019577   Transcript: ENSMODT00000024856
Sequence length 362
Comment pep:novel chromosome:BROADO5:1:123190487:123203935:1 gene:ENSMODG00000019577 transcript:ENSMODT00000024856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLVLLIVFLLPSGSPGLPFYNGFYYGNVMNDRSYRNGNGEGFFNGVKLVVETPEEPLFT
HRGANVTLPCRYHYEPALTSSRPVRIKWWKLGENGAPERDVLVAIGLRHRSFGAFRGRVH
LLQEKEQDVSLVIHDLRLQDYGRYRCEVIDGLEDESGVVELELRGVVFPYQPPYGRYRLN
FHEAQLACEKQDAVVASFEQLFRAWEEGLDWCNAGWLLDGTVQYPITLPRQPCGGHGLAP
GIRSYGERHKRLHRYDVFCFSSSVKGRVYYLEHPEKLTLAEAEEACQEDGAHIAKVGQLF
AAWKFYGLDRCDAGWLADGSVRYPVTRPRPNCGSLEPGVRSFGFPDKESRRYGVYCYRQS
WH
Download sequence
Identical sequences F6QN25
ENSMODP00000024423 ENSMODP00000024423 XP_001370515.1.35504 XP_007479425.1.35504 XP_007479426.1.35504 XP_007479427.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]