SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024446 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024446
Domain Number 1 Region: 2148-2371
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.02e-81
Family Fibrinogen C-terminal domain-like 0.00000139
Further Details:      
 
Domain Number 2 Region: 893-1065
Classification Level Classification E-value
Superfamily Fibronectin type III 4.12e-21
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 3 Region: 1978-2143
Classification Level Classification E-value
Superfamily Fibronectin type III 2.43e-19
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 4 Region: 1885-1974
Classification Level Classification E-value
Superfamily Fibronectin type III 6.91e-19
Family Fibronectin type III 0.00002
Further Details:      
 
Domain Number 5 Region: 713-886
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-17
Family Fibronectin type III 0.0000138
Further Details:      
 
Domain Number 6 Region: 623-709
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-16
Family Fibronectin type III 0.00081
Further Details:      
 
Domain Number 7 Region: 1344-1429
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-16
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 8 Region: 1077-1161
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000105
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 9 Region: 1798-1885
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000143
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 10 Region: 1252-1338
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000156
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 11 Region: 1527-1611
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000182
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 12 Region: 1169-1247
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000443
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 13 Region: 1435-1520
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000628
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 14 Region: 1616-1703
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000067
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 15 Region: 1707-1794
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000704
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024446
Domain Number - Region: 255-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 411-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000377
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 349-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 225-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 534-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 380-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00385
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 504-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00402
Family Integrin beta EGF-like domains 0.032
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00444
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 286-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0072
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 566-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 596-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 442-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family Integrin beta EGF-like domains 0.096
Further Details:      
 
Domain Number - Region: 318-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 473-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024446   Gene: ENSMODG00000019592   Transcript: ENSMODT00000024880
Sequence length 2378
Comment pep:novel chromosome:BROADO5:1:405505487:405622138:-1 gene:ENSMODG00000019592 transcript:ENSMODT00000024880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLTQVLAYTIVALLSHSTQAGVLKRVIRHKRQSGINVTLPEENQPVVFNHVYNIKMPM
GSHCSVDLESASGDKELNPATELGEHFQEHTLNEENQIVFTHRINIPRRACGCAPAPDIK
ELLNRLEELEGLVSSLREQCSSGAGCCLQPAEGRLDTAPFCNGRGNYSTDSCGCVCEPGW
KGPNCSEPECPGNCNNRGQCIDGQCVCDEGFTGEDCGQLACPSDCNDQGKCVHGACVCFE
GYTGEDCSEELCPVPCSEHGKCMNGQCVCDEGFAGEDCKEPLCLNNCYNRGRCVENECVC
DEGFTGEDCSELICPNDCYDRGRCVNGTCYCELGFTGEDCGQLTCPNGCNNQGQCEEGQC
VCDEGFAGDDCSEKRCPEDCHNHGRCIDGQCECDDGFTGEDCGELKCPRDCSRHGRCVNG
QCVCDEGYTGEDCANRRCLNDCNNRGRCVHGKCVCEQGFTGYDCGDMSCPNDCHHQGRCV
NGMCVCDDGFMGEDCRDLRCPKDCNHRGICVAGKCKCQEGFAGEACGELACLNNCNNRGR
CVNGQCVCNEGFMGRDCSDLRCPNDCNNQGRCVEGKCICHEGFGGDDCSQLSCLNNCNDW
GQCVGGRCICNEGYTGEDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLVTYTPTNS
DGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFK
AIKETSVEVEWDPLDIAFETWEIIFRNMNKDDGAEITQSLRRPETTFRQTGLAPGQEYEI
SLHIVKNNTRGPGLKKIATTRLDAPSQLDVKDVTDTTALISWSKPLAEIDGIELSYGIKD
VPGDRTTIDLTHDDNQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFVTGLDAPRNLKR
ISQTDNSITLEWKNGKANIDNYRIKFAPISGGDHAEIEVPKSKQATTKTTLTGLRPGTEY
GIGVSAVKDDKESNPATINAATDMDAPKDLQISEPTETTLPLLWRRPLAKFDRYRLTYSS
STGQQKEVQLPADTTSYILRGLNPGTEYAIHLVVEKGRHKSKPSRVKGSTKEAPGLGNLT
VTDVSWDALKLHWTAADGAYDNFVIQVQEANKLEEVQNLTVSGSLRAVDITGLQAATPYR
ITISGVIQAYRTRPLSAEISTEKTPKLAELTVSEVSWDSLKLNWTTTDGDYENFVIQVQE
ANRTLTIPGGQRSVHVTGLTAATLYRITIHGVIRGFSTHPLSIQATTEEVPELGNLTVAK
VSWDSFKLNWTAADGAYETFVIKVQEANNLEEAQNLTVSGKLHSADVLDLQAETPYTITL
YGVIRGYTTEPLSAEATTEEAPKLRGLTVSEITWDAFTLNWTVANGPYENFVIWVQEVDQ
PEELHNLTVASVQNSMEVTGLKPATHYRITITGVTGGYRTEPLSAEASTEELPKLGELTV
TNISWDALKLHWTTAEEAYDSFVIQVQEANKLEEVQNLTVSGSLRAVDITGLQAATPYRI
TISGVIQAYRTRPLSAEASTVAEPLLSHLTVSNITSGSVSLSWKAQEAAFENFVLEVRNS
DLPLDSVVYTVPGALRSSVITNLRASTNYTVQLHGLIGRQSGQTLMAQATTEPELQVGQL
ILTNVTPDSFNMSWTTSAGLFAKFDINVSDSHSLYEPQQHTVSGDTQHAYITGLVDNTGY
DISIRGTTWAGDQTEPLTAFVTTEALPLLENLTISDINPHGFTVSWMASENAFDSFLVIV
VDSGKLLDPQEFTLSGAQRKLELKGLITGIGYEVMLFGLAQGHQTKPLSAVAITEAEPEV
DNLLVSDATPDGFRLSWTADEGVFDSFVLKIRDTKKQSDPLEISVPTHERTRDITGLKEG
TEYDIELYGLISGRRSQPINAIATTAMGSPKEISFSDITENSATVSWTAPTSLVESFRIT
YVPVEGGMPSMVTVDGSKTQTGLVRLMPGVEYLVSIISIKGFEESEPVTGTLTTALDGPS
GLVAANITDSEALAMWQPAIATVDSYVISYTGDRVPEVTQTVSGNTVEYALNDLEPATEY
TLRIFAEKGPQKSSIITTHFTTDLDSPRDLVATEVQSETALLKWRAPRAPVTGYLLIYES
VDGTIKEVILGPDTDTYSLTELSPSTHYTAKIQALKGALRSKLIQTIFTTIGLLYPYPKD
CSQTMLNGETASGLYTIYINGDKTQALNVFCDMSSDGGGWIVFLRRSNGHQDFYQNWRTY
ATGFGKLGDEFWLGLDNIHKITNQGQYELRVDLRDRGETAYAIYDKFSVGDAKSRYKLKV
DGYSGTAGDSMAYHNGRFFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNH
SQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Download sequence
Identical sequences F6Y8P7
XP_007474594.1.35504 ENSMODP00000024446 ENSMODP00000024446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]