SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024836 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024836
Domain Number 1 Region: 772-967
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-39
Family Fibronectin type III 0.0000406
Further Details:      
 
Domain Number 2 Region: 1064-1173
Classification Level Classification E-value
Superfamily Fibronectin type III 8.39e-24
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 1181-1274
Classification Level Classification E-value
Superfamily Immunoglobulin 2.49e-23
Family I set domains 0.0036
Further Details:      
 
Domain Number 4 Region: 663-693,724-780
Classification Level Classification E-value
Superfamily Immunoglobulin 2e-17
Family I set domains 0.0000318
Further Details:      
 
Domain Number 5 Region: 156-258
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-17
Family I set domains 0.00000703
Further Details:      
 
Domain Number 6 Region: 464-542
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000145
Family I set domains 0.0011
Further Details:      
 
Domain Number 7 Region: 373-452
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000705
Family I set domains 0.00011
Further Details:      
 
Domain Number 8 Region: 983-1072
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000013
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 555-630
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000319
Family I set domains 0.0048
Further Details:      
 
Domain Number 10 Region: 12-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000064
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024836   Gene: ENSMODG00000019908   Transcript: ENSMODT00000025277
Sequence length 1276
Comment pep:novel chromosome:BROADO5:5:284254624:284277716:-1 gene:ENSMODG00000019908 transcript:ENSMODT00000025277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPGKKAVSAFSKKPKSAEAAVGSSALFEAETERAGLKLRWQRAGSDISASDKYVLTSE
GTRHTLTVQDVQPDDQGLYAAIAGTSKVKFELKVKEAALPINNSLFWSRPEKPDLVPAPK
DTPSPGIGSPQNREANLLRSLLATCEEASGDPIGLFVSRPQDGEVTVGDSITFSAQVAGA
SLLKPPVVKWFKGKWMDLSGKVGKNLQLHDSYDRASKVYLFELHISEVQAAYAGGYRCEV
STKDKFDSCNFNLTVHEAIGPADLDLRSAFRRPSLPGGNRRTSGDGHDDAGSLDFSSLLK
KSLFRLVGARDPKLEAPAEEDVWEILRTAPPSEYERIAFQHGVTDLRGMLKRLKGMKKDE
KKSAAFLKKLEPAYQVNKGQKIRLVVEVADPDAEVKWLKNGQPIQMSGRCVYIFESAGNK
RMLTISQCSLADDAAYQCMVGGDKCSTELFVKGDFALAEPPVLITRGLEDQMVTVGQRVE
FECEVSEEGAPVKWLKDGVELTREETFKYRFKKDGRKHHLIINEATLEDSGHYAIRTSGG
QALAELIVQEKTLEVYQNIADLTVGARDQAVFKCEVSDENVKGVWLKNGRELVPDSRIKV
SHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCP
GRTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKASQESKTPDPATEVGDSSEWVFEKKLL
CETEGRVRVETHKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNITVKVIDVPDPPAAP
KISNVGEDSCTVQWQPPAYDGGQPILGYILERKKKKSYRWMRLNFDLLRELSHEARRMIE
GVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLGVEDISDSSVTLKWRPPERVGA
GGLDGYSVEYCREGSSEWVSALQSLTERTSLLVKELPTGARLLFRVRAHNLAGPSAPAIT
KEAITVQEILERPRLRLPRHLRQTVQRKVGEPVNILIPFQGKPRPQVTWTKEGQPLAGND
VSIRNSPTDTILFIRTAHRAHSGTYQVAVQIENMEDTATLVLQIVDRPSPPQEVRVTETW
GFNVALEWKPPQDDGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVSELIMGNNYYFR
VFSHNMVGASEKAATTKEPVFIPKIGLTYQPPTYKALDFSEAPSFTQPLVNRSVIAGYNA
VLCCSVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGAYVCRATNA
QGEAQCECRLEVRGKD
Download sequence
Identical sequences F6VQ74
ENSMODP00000024836 ENSMODP00000024836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]