SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025257 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025257
Domain Number 1 Region: 24-136
Classification Level Classification E-value
Superfamily Immunoglobulin 9.68e-23
Family V set domains (antibody variable domain-like) 0.00031
Further Details:      
 
Domain Number 2 Region: 111-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000741
Family C1 set domains (antibody constant domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025257   Gene: ENSMODG00000020194   Transcript: ENSMODT00000025706
Sequence length 231
Comment pep:novel chromosome:BROADO5:5:294788933:294792766:-1 gene:ENSMODG00000020194 transcript:ENSMODT00000025706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGRTGPYICVFLDLKMYDLLNGKFTVIGPHEPIIALVGREVTLPCYLHPKLDAQNMEVVW
FHGQNSSLVYHYKHAWDYLKYQHQDYQGRTEFLQENITSGNVSLRIHHIRPSDEGKYRCF
FESSSYYHEAEFQVYVAGECSAPHIYKESAGNKRLYLVCTSTGWYPEPEVQWKNHQEEPL
SGGSVTMKKVNGLFSVEMSIIVSANSKENVSCVIGILHFSQKMEASFNLAG
Download sequence
Identical sequences F7G8B5
ENSMODP00000025257 ENSMODP00000025257 13616.ENSMODP00000025257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]