SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025329 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025329
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily C-type lectin-like 7.13e-39
Family Link domain 0.0061
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-23
Family Link domain 0.0029
Further Details:      
 
Domain Number 3 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 2.78e-16
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025329   Gene: ENSMODG00000020249   Transcript: ENSMODT00000025779
Sequence length 354
Comment pep:novel chromosome:BROADO5:3:223492343:223530687:1 gene:ENSMODG00000020249 transcript:ENSMODT00000025779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLLFLVLISLSWADHLTDNYTLEHDRIIHIQAENGPRLLVEAEQAKVFSHRGGNVTLP
CKFYRDPSTIGSGTHKIRVKWTKLTSDYLKEIDVFVSMGYHKKTYGSYQGRVFLNRGSEN
DASLVITDITLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYNLNFHEARQA
CLDQDSVIASFDQLYDAWRAGLDWCNAGWLSDGSVQYPITKPREPCGGRNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGSQIAKVGQMFAAWKLLG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFAGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences F7CKI8
XP_007487406.1.35504 13616.ENSMODP00000025329 ENSMODP00000025329 ENSMODP00000025329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]