SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025350 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025350
Domain Number 1 Region: 166-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000201
Family I set domains 0.048
Further Details:      
 
Domain Number 2 Region: 81-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000559
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025350   Gene: ENSMODG00000020265   Transcript: ENSMODT00000025800
Sequence length 341
Comment pep:novel chromosome:BROADO5:3:227615664:227655623:1 gene:ENSMODG00000020265 transcript:ENSMODT00000025800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSPEVLWAPLSLSFLLYVAGPCFSEGTTTDADFTTEIPTEETISMDKENVTSSTGFYP
ELISMEASLLVMGTSDVPVEKNVTVGNPANIELKCNFSTTQKPHSMYAVWKKGNDVINRT
SNVQVIDNVLQTYIRLMITERMHLGSYSCIIEEANVQKGIFNLEVPVVYTKEKPLVNYER
DSVVLYCNTKTYVPSEWIWYSSNGSEKVPIDIDVKDKYEILPSTLNETKIKIKHLKATES
GLYWCHAIFPLGESEGKQFLKVLTYLVPLKPFLAVTAEVIILVTGIFLYEHYTKKKQMPS
EDGKDFEQSERLKSEDHNGVQKDEHRTRHRKSEASVNFCSN
Download sequence
Identical sequences F7C1C3
ENSMODP00000025350 ENSMODP00000025350 XP_007487447.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]