SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025374 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025374
Domain Number 1 Region: 50-142
Classification Level Classification E-value
Superfamily Fibronectin type III 3.31e-31
Family Fibronectin type III 0.0000124
Further Details:      
 
Domain Number 2 Region: 143-247
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-18
Family Fibronectin type III 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025374   Gene: ENSMODG00000020284   Transcript: ENSMODT00000025825
Sequence length 630
Comment pep:known chromosome:BROADO5:3:231753269:231937246:-1 gene:ENSMODG00000020284 transcript:ENSMODT00000025825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLGPPSLYFREVCRTAGPTGMDLWQLLLTLALASSNDAFSQSEEPSGKPQYTKCRSPE
LETFSCYWTDDIYHGAKSPIKLLYKKRTDEEWKECPDYVSAGENSCYFNSSYTSIWTPYC
IKLRNISHELEKRCFTVDEIVQPDPPIGLNWTLLNTSLTAIHADIQVRWGPPPNADVQKG
WILLEYELQYKEINDTQWKKMELVRSTSVPVYSLRLDREYEIRVRSRQRTSEKFGEFSEI
LYVTFPQMSPVSECEEKINDFRFPWFLIIIFGILGLTVVLFVFILSKQQRIKLLILPPVP
VPKIKGIDPDLLKKGKLEEVNTILASHDSYKPQFYNDDSWVEFIELDIDDPDEKAEESDT
DRLLSSERQKSLNYLGAKDDDSGRTSCYEPDILETDLSAPASCDSTSDIAHSQRLPGTAD
LFCLEPKNEASPSTTPPPSGGLLSEGGQPRPLLPNGMESSSLAVHAHLSNQSSLANIDFY
AQVSDITPAGSVVLSPGQKSKAGISQCDGHREASPCRGNFILDNTYFCEADAKKCVSVAP
HAEPEPRTEPRFSPEDVYITTESLTTTAGSSGIAGGPSGAEMPVPDYTSIHIVQSPQGLV
LNATALPVPDKEFLTSCGYVSTDQLNKIMP
Download sequence
Identical sequences F7C0F5
ENSMODP00000025374 XP_007487298.1.35504 ENSMODP00000025374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]