SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025394 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025394
Domain Number 1 Region: 563-626
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000514
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 491-537
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 30-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000445
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 83-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000929
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 618-680
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000848
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025394
Domain Number - Region: 193-247
Classification Level Classification E-value
Superfamily Smp-1-like 0.0262
Family Smp-1-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025394   Gene: ENSMODG00000020299   Transcript: ENSMODT00000025845
Sequence length 836
Comment pep:novel chromosome:BROADO5:3:233882435:233955299:-1 gene:ENSMODG00000020299 transcript:ENSMODT00000025845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLPNMKVLIFILVVFMESFQVFSSSLQAINCVWHPYDSWSECDGCTKTQIRRRHIAVYG
QYGGHPCVGDAFQTQTCVPTRGCPAEDGCGSLFRCSSGQCLSKSLVCNRDRDCEDGSDED
LCELPEGKPLCDIDRPPPHVEYTGTGFNVLTGQIKDMVINTKSFGGQCRKVYNGDQKDYF
RLSANALSYTFQVKVDNDFSYEFYNSSWSYVKHEETSFTSNSEHRHYSNKDKTQDEKSYQ
LMVIKNSVEVAQFINNQPEFLNLAELFWKDLLHLPSLYDYSSYRRIIELYGTHYLQSGSL
GGEYKVLFYVDTDKMKQNDFNLQDMTQCTLSNWNLFFVKVSKQKCEKLIELFKLVSETKD
NLLRGNAFVKGGNPALVADLSYLNMNDPAGNRGRYASWAATVGQYPQIIKQKLAPLYELV
KDVPCASVKRIYLKRAIEEYLAESDPCHCKPCENDGLAVVVGTQCQCHCKPYTFGIACEH
GFLVEDQAGTVDGRWSCWSPWSSCTEGRKVRRRSCDNPRPSGGGKFCNGEAFEMQPCKDE
ELEHIRLIEPHCFDMSGVSTASCSPPPHLENGFVQDTGSSFPVGRTVVYSCQEGYALVGD
PVAKCGEDLTWLIGEKHCQKIGCVLPALERGLQSDPQKPFYEVGEKVTLVCSGSLVLEGS
SLFSCGSSLKWWPDMNSHCRLKESTEKPLPAQPCQPWEKLQNSRCVCKMPYECGPSLDIC
AQDGRTKKIVALTVCKLHVLECMGRSYTLMNSGSCSLPVPAERTCSTCSIWEKCDAQINK
CVCRESAANCVEGGFNICVEVDGSEQTMTECEAGILRCQGLSISVVSIRPCGTKRK
Download sequence
Identical sequences F7BFI5
XP_007487476.1.35504 ENSMODP00000025394 ENSMODP00000025394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]