SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025415 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025415
Domain Number 1 Region: 327-510
Classification Level Classification E-value
Superfamily Fibronectin type III 5.33e-17
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 2 Region: 224-314
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000199
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 3 Region: 528-714
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000428
Family Fibronectin type III 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025415
Domain Number - Region: 33-135
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0941
Family Fibronectin type III 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025415   Gene: ENSMODG00000020318   Transcript: ENSMODT00000025866
Sequence length 956
Comment pep:novel chromosome:BROADO5:3:236568451:236657923:-1 gene:ENSMODG00000020318 transcript:ENSMODT00000025866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFFLTLQTLFLLVLIHLSTCRSEGLSEYLQYPPESVNVSIHSNEQCLHIEWAVPLPAYM
LNLKMTFQIDIRRSANSDPVEDKNYTTTLKPNETLQWCWHSMLPLQCISHSVRIRSMIDD
ERFPESRNWSSWSKWEESQGQDSSGQLLIFPSSIIYAEEDSNVTFCCISRTDNDNMTIYF
EGKIMQGIKLSPRVTMFEVNNIPFIRTTGSNAVCKLNPSGDFVGTVLYIGGVLEEPKNFS
CETRDLQTLNCTWDPGRDTLLPERLPKNYTLFEWYSKKKIVCNHRNWCIWQLAPEVQEKY
NFTLMAENKLRKRRTSISFNVTQQVQPKHARKISVENVSDTEATLTWQMIPVQKKISFLC
QIEVYHDGKVIQYNTSNSEFTLRELQPYMGYSTQVRCCTANHFWKWSEWSSKNFTTKEAA
PSGSLDIWRNVQPVLEGYNVKLFWRPLPTFQANGKILNYSIVMEALGKVPKVDISFSESP
STEKIIDQQPYKISIKAINSAGSSTPSVIVVSGDTENRSIKEDRVNGTGDGIDLSWKPDP
RGVEGYVVDWRNPPHDSIGGFQWKKFSPNTTNAVIKSATFQPGVRYNFRIYGLSANHEAY
LLEKKTGYTRELALDCKPVVAVNNLASTSLTLMWTDNCANEPQYGFFKGYHIYMKPEAGS
CDLDAEKEVFSDNLEVCKYTVTNTEQKTFNVMKLQPNSTYTFEVKAFTGGGDSLGHILRV
STVAVENTNLLMTILFPLAFISLLLIIGLNMKIHWVKEKCFPDIPDPYKSSVLSLLKFKG
SIHQAILNTNDCIPDAIEVINRPEISKTQGSSTLVGNEISKPAYLYLLPTGKDPLDPQSC
ICFENFTYCQAASDIGSHIQMIPTDPIRSVEPPEHLLKVEKDYMGSLGNIPAEEDASLNY
VAQLAPTMSGDKGYSSPNLPEATHCSEYKMQMVISTDLTLSLPLEGERPISDASLD
Download sequence
Identical sequences F7G7H8
ENSMODP00000025415 XP_007487492.1.35504 XP_007487493.1.35504 XP_007487494.1.35504 XP_016287084.1.35504 ENSMODP00000025415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]