SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025425 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025425
Domain Number 1 Region: 431-626
Classification Level Classification E-value
Superfamily Fibronectin type III 5.03e-22
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 328-427
Classification Level Classification E-value
Superfamily Fibronectin type III 5.84e-21
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 724-833
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000027
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 4 Region: 46-124
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000133
Family Fibronectin type III 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025425
Domain Number - Region: 642-730
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0091
Family Fibronectin type III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025425   Gene: ENSMODG00000020327   Transcript: ENSMODT00000025876
Sequence length 1101
Comment pep:novel chromosome:BROADO5:3:237096665:237177485:1 gene:ENSMODG00000020327 transcript:ENSMODT00000025876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVYFYLRLLLKRGENKRMRNSSKFQWLSSVIFLYLVNQAHGQKRGVPHDLKCITHNLKI
WDCSWEASYRINHGTTYEVCIVNSSYSCIQTEKTHFEIPALSLADHEIKISSTHVSGNSV
TKFILSERNVSLVPATLQILNLTADFSTSTLYLKWNDNGSAFPHHSNVIWEIIVLYKEDM
EVATVATFNTTLMGKDSVHHWNWTSDIPLECTAHHVKIRYYIDELHFFGQKEWSEWIPLR
ISGSPIKESYEVFPRDKVVPVGSNMMFCCVVEETVLTAQYGSEKCSLIPLDNKSVGIKIN
NITISPSSGTNVVFTTRSNLYGTVVFAGYPPDIPKKLNCETRDLKEIICSWNPGRPTGLV
GPRDTNYILYERFSGRNVTYKRDEEHMNENHQLIFQMISGQERYNFTLKASNPLGGSEAV
ILVDITQRVYPHTPSKLNVKGINSTAIFLEWHLSGNFANINLFCEIEINSAYSGQELRNI
TVKGLETSSYHVSVDKLIPYTMYTFRVRCSSEKFWKWSKWSNEKQYLTMEGIPSKGPDIW
REWSADGKSVIIYWKPLPFNEANGKILSYDVSYGLEEETQYLSEIPDPHHKAEIKLDRND
YNDYIISVVAKNSVGSSPPSKITSLEIPNEDLKMEQVVGIGNGILFHWNYDLNMTCDYVI
KWCNSTRSEPCLIDWKKFPANSTGALIEYDNFQSGTRYNFFLYGCKNQKYQLLRSIVGYT
EELAPNVAPNFTVEDTSADSILVKWEDIPVEDLRGFLRGYLFYFEKGEKGTSKIQGLESE
TRRSDVKVKNITDITQKTLRIVDLQGKTGYHLLLQAYTDGGVGPGKAMYVVTKENSEGLI
IAILIPVAVAIFVGVVTSILCYRKREWIKETFYPDIPNPENSKALQFHKSVCEGSSALKT
LEMNPCTPNNVEVVETRSAAPKIEEDTEIKSPVAVVPEEGSDAEPENHVVVSYCPPIIEE
EIANAGGEEAGGSSQVIYIDIQSMYQPQAKPEEELENNSVGGAGYKPQMHLPVTSTVENI
IVADDLEKTAGYRPQANVNAWNLDSPDSPRSIDSNSEVVSFGSPCSINSRQFLIPPKDEE
SPKSSNGGWSFTNFFQNKPND
Download sequence
Identical sequences F7G7B6
ENSMODP00000025425 XP_007487495.1.35504 XP_007487496.1.35504 XP_016287081.1.35504 XP_016287082.1.35504 ENSMODP00000025425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]