SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025476 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025476
Domain Number 1 Region: 126-232
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000141
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025476   Gene: ENSMODG00000020367   Transcript: ENSMODT00000025927
Sequence length 456
Comment pep:novel chromosome:BROADO5:3:240375023:240406742:-1 gene:ENSMODG00000020367 transcript:ENSMODT00000025927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVLSTTIGIIFFLLHSSSGESGCGKDDGFEDEEQDDYEFTCYSQLQGHGQEHTLTCYFN
NLTLHSNDLELKLCGAFMSEPQCEMMIKRENDYFMKSRSFSLINTCEINVILGRSKVNYK
SFKITKIVKPEAPFDLNITYRKAANDFVLTFSTTHSWNDHYVKELIHDIAYHQEKSQSDW
THIRSSYPHITLLERKLQPNSTYEVKIRSFPGGEYFSGYWSDWSPTVYFRTPLRPKAEEL
DFVMLFIITLSFSSGILGIVVICLLWEKRIKPVLWPNLPDHKTTLEQLCRKPQKNFSNSF
NPECFLDDKIHKVDGIQSKEEVEGFLQVSLPQDINAAEKFGLSPDWPSENNIIPPVAFGG
NSPPTCLDGNFNTCDLSVLMASKSPNQQENSKNEAHSCGGLLLSSDSRNSALVFPFPLKL
GVLSPNPTAPGQPINADLRLSQEEAYVTMSSFYQNK
Download sequence
Identical sequences F7FJP7
XP_001373020.1.35504 ENSMODP00000025476 13616.ENSMODP00000025476 ENSMODP00000025476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]