SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025486 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025486
Domain Number 1 Region: 30-131
Classification Level Classification E-value
Superfamily Fibronectin type III 2.63e-34
Family Fibronectin type III 0.00000959
Further Details:      
 
Domain Number 2 Region: 137-235
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-20
Family Fibronectin type III 0.00000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025486   Gene: ENSMODG00000020376   Transcript: ENSMODT00000025937
Sequence length 636
Comment pep:novel chromosome:BROADO5:3:241538810:241627653:1 gene:ENSMODG00000020376 transcript:ENSMODT00000025937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLLKEKEANMKENVTSTTIFLLLLFLNTNLLNGQSAPGKPKIEKCRSPEKETFTCWWK
PGSDGGTAANYTLFYRKEGESLTHECPDYKTGGPYSCYFNKKHTSIWMIYIIWVNATNQM
GRSMSEPHYVDVTYIVEPDPPLNLTLEVKQSEDRKSYLLLKWSPPALVDVRSGWLTLQYE
LRLKPEKAPEWETHFAGQQTQFKIFSLYPGQKYLVEVRCKPDHGSWSQWSPENSIVIPSD
IKMKDTTVWIFVAILSSVVCLIMVWTMALKGYSMITCLLPPVPGPKIKGFDTHLLEKGKS
EELLSALGCQGFPPTSDREDLLVEYLEVDDSEDQQLMPTYEKDHPSQGRKPTQLDPDNDS
GRGSCDSPSLLSEKCEEPRIPAPTFTIPEVNEKPDDPGTNVTHNWDPQGINFKGKNPYFN
ALGSKSSTWPIPQQSSNHSLRCSYHNIADICKVALGTVNGPTVSLGKEENHALNYPTTID
TGGEETTDKQNELGHFHSNVDQGTTWLLPNEKMPFMSPRPMDYVEIHKVNKDGALSLLPK
QKESNGNTEQASAPDSSKEYAKVSRVMDNNILVLMQDPRAQTRVIFEESAKESPQPLQHN
QAEKNLSYCTFPPGDCRLQTGGLDYLDPTCFIHSFN
Download sequence
Identical sequences F7F6E0
ENSMODP00000025486 ENSMODP00000025486 XP_001365470.2.35504 XP_007487526.1.35504 XP_007487528.1.35504 XP_016287101.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]