SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025507 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025507
Domain Number 1 Region: 1673-1955
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.75e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000971
Further Details:      
 
Domain Number 2 Region: 1352-1491,1556-1585
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000587
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 3 Region: 729-809
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000114
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 4 Region: 206-362
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000365
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 5 Region: 109-202
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000001
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 6 Region: 641-721
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000154
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 7 Region: 906-984
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000213
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 8 Region: 465-548
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000578
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 9 Region: 817-896
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000665
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 10 Region: 1171-1250
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000077
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 11 Region: 1253-1348
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000193
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 12 Region: 1083-1163
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000322
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 13 Region: 552-641
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000522
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 14 Region: 375-456
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000513
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 15 Region: 993-1084
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000199
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 16 Region: 30-100
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000398
Family Fibronectin type III 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025507   Gene: ENSMODG00000020392   Transcript: ENSMODT00000025958
Sequence length 1989
Comment pep:novel chromosome:BROADO5:8:38023041:38140729:-1 gene:ENSMODG00000020392 transcript:ENSMODT00000025958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSYGARLALWMALNLMQSGLGEPPRCNINQTQAKVSSQSARLRWSTEGSPCNFSLIYNS
DTSGSALCYPVRVANHTYECNPEDLQAGTVYHFRIVSEDGDEKPISLQTDPLPPARFEVD
MDKTTSTSLHVWWTPSSGKVDFYELQLFNDKNQKIQGAVIPESTLQNENTFSNLTAGTKY
HFAIQAISGNKSSPAVYINGSTVPFPVKAVQASTNTDTLQVSWSSGSGNVDQYRVMLLDK
GRTIHDISVEKHVTTHTFLGLTPGHLYNLTIVTEAAGLRSYKSKLVRTAPVEVSNLMVTN
EASCSSLKVKWKRPPGNLDCYNITLSHQGNVREFRTIEAWVTEAHFEGLIPGRLYQVTVS
TISGELSAQKTAMGRTVPEKVTKLKAVSNGWMRSLRVSWLPPTGDWERYRITLLNGSSLL
LNITLEKDTKSFDIHDLGLIPGRQYEVEVSVESGGLKNTIRCQGRTTPQPVGQLRVKHAN
ESSLSIMWLTPVAEWDKYVISLADRDLLLIHKTLAKEAKEFTFTDLVPGRKYVASVTSIS
GDLRNSTSVEGRTVPAQVTGLNVFNQGTTNSLFTNWTRAQGDIDFYQVLLIHENVVIKNE
SLSSETSGYSFHSLKPGGLYSVVVTTFSGGISSRQMVGEGQTVPSSVSGVTLNNSGRSDY
LSVSWLPAPGDVDSYSVTLSHGDQIIQSLAIAKSTSECSFSSLTPGRLFNVTVTTRSGKY
ENHSFGQERTVPSKVQGLTISNSARSDYLKVSWLHATGDFDQYVVGITNKNNSVQTKTIP
KTGNECVFVNLVPGRLYSITVSTRSGNYEASERLNKRTIPESVKELTLRNRSTEELHVTW
VRADGDVDQYEIQLCFNDVKVLPSLHLINTATEYRFTSLTPGRLYKILVLTISGDAQKSA
FIEGLTAPSPVKNIHVSPNGMTDSLKVNWTPGGGDVDSYTVTALRQHHKIDSQTIPKHIN
EHTFHKLEAGELYQIVVESISGSLSNQVETLGRTVPASVQGLHADNAYSSHSLIVTWQGA
AGMAERYDILLLSEEGTLLSNKSEVASAKQHKFEDLIPGKKYKIQILTVSGGLFSVQAET
EGRTVPAAVTNLRITENSTSHLAFTWKTSEGELNWYNIFLYNPDKTLQERAKVDPGVQHC
AFQNLMQGRMYKMVIVTHSGELSNESFIFGRTVPATVNNLKGSNQNMTDSLLFTWSPAPG
DLDSYELILYNPNGSQKEKWKAKDLTEKHFHSLVPGRMYTLSVVTHSGDLTNTIKATTPS
PPSSLSFADVANTSLAITWLGPQDWTDYDDFELQWFPRDQLTIFNPYSNRKSKGRIIYGL
HPGRFYQFSVRTVSGESWKTYSQPISGTVRTRPDKIQNLHCRPQNSTAIACSWIPPDSDF
DGYSIECRKVDTGEVEFSRRLDKDKSLLNIMTLVPHKQYRVSIKVQSERMTSEVVEETTI
TMIDRPPPPPPHIRVNKKDVLISKSSINFTFNCSWFSDTNGAVKYFTVVVREADGNDELK
PEQHHPLPSYFEYRHNASIRVYQTNYFASKCAESPESNSKSFDIKLGAEMERLGGKCDAN
QQKFCDGPLKPRTAYRISIRAFTQLFDENLKEFTEPLFSDTFFSLPITTESEPLFGVIEG
VSAGLFLIGMLVAVIALFICRRKVSHGQNRPTARLSIRRDRPLSVHLNLGQKGPIKVNQF
EAHFMKLQADSNYLLSKEYEDLKEVGRNQSCDTALLPENRGKNRYNNILPYDTTRVKLSN
VDDDPCSDYINASYIPGNNFRREYIATQGPLPGTKDDFWKMSWEQNVHNIVMVTQCVEKG
RVKCDHYWPADQDSLYYGDLIVQMLSESVLSEWTIREFKICSEEQLDANRLIRHFHYTVW
PDHGVPETTQSLIQFVRTVRDYINRTPGAGPTIVHCSAGVGRTGTFIALDRILQQLDSKD
SVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEY
HRDAVYSRH
Download sequence
Identical sequences F7C049
ENSMODP00000025507 ENSMODP00000025507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]