SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025564 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025564
Domain Number 1 Region: 425-650
Classification Level Classification E-value
Superfamily Caspase-like 5.98e-39
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 105-212
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-23
Family DEATH domain, DD 0.0053
Further Details:      
 
Domain Number 3 Region: 313-391
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000208
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 236-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000199
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025564   Gene: ENSMODG00000020434   Transcript: ENSMODT00000026016
Sequence length 906
Comment pep:novel chromosome:BROADO5:3:246986776:247075077:-1 gene:ENSMODG00000020434 transcript:ENSMODT00000026016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVRGSPGMSLASWPRAPGRGGAGTWGNLSLPREKLLPPRCTAKPPSDVSFRPRPGLGRR
GEFRSESGRWLESVGRAAGRDSGTGDMSLWGHTLQAPPPSLAPTVPGSPSLGAVNINRLR
EPALRGLSDALDRAADGRGWKKLAELAGTRGRYRLSCLDLEQCSLKVLEPEGSPSRCLLK
LLGEKGCTVTELSEFLQAMEHTDVLQLLGPPGLFLRLNSEKRKVIFGKLTIFFSICQLCX
PFVQYQWFKMKKEIPHGNSPELIFNPVLVKDSGFYVCRVNNNSTFEFSQWVQLDVCEVSE
SSCRSLDGFSETKLQICIEPKSQKLRPGNSLVLQCVAIGSPIPHYQWFRNGFPITHGTKK
SYMVPYVDLEHQGTYWCHVYNDQDNQDSKKVEVFIGRTDEAVECTEDELNNLGHPDIKDE
STDRPFAKDKVALLIGNMNYWNHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRN
AVDEFLLLLDQGVYGLLYYAGHGYENYGNSFMVPVDAPNPYRSANCLCVQSILKLMQEKE
TGLNVFLLDMCRKRNDYDDTIPILDALRVTANIVFGYATCQGAEAFEIQHSGLANGIFMK
FLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQQTLCSPES
LVRNLQWAKAHELPESMCLDFKSGVQIQLGFAAEFSNVMIIYTRIVYKPPEIMMCEAYVT
DFPFDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYEYP
GMEDTIEERQEVNVGKPLIAKLDIHRGLRRKSCFQSCFMPNSHCQNPTPTSVAAEHYHSS
PDSFQIVYHSDPDHSGNCHCNQSSDTLISSHGAQNYCSPFIRSNIPEETTDELPFAFSDQ
LTFSEK
Download sequence
Identical sequences F7AR74
ENSMODP00000025564 ENSMODP00000025564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]