SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025624 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025624
Domain Number 1 Region: 1987-2265
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000129
Further Details:      
 
Domain Number 2 Region: 681-868
Classification Level Classification E-value
Superfamily Fibronectin type III 3.81e-44
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 3 Region: 409-460,544-669
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-38
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 870-1067
Classification Level Classification E-value
Superfamily Fibronectin type III 3.37e-38
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 1259-1430
Classification Level Classification E-value
Superfamily Fibronectin type III 5.8e-38
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1070-1256
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-33
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1442-1632
Classification Level Classification E-value
Superfamily Fibronectin type III 2.94e-31
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 8 Region: 69-216
Classification Level Classification E-value
Superfamily Fibronectin type III 6.88e-31
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 9 Region: 168-214,281-407
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-28
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 10 Region: 1584-1751
Classification Level Classification E-value
Superfamily Fibronectin type III 7.69e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 11 Region: 2-74
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000487
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025624   Gene: ENSMODG00000020476   Transcript: ENSMODT00000026077
Sequence length 2304
Comment pep:novel chromosome:BROADO5:8:50434482:50722459:1 gene:ENSMODG00000020476 transcript:ENSMODT00000026077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGHVERYHVDLIPDGGVVAIRDLGHGEYQVDVSNALPGTRYNVTISSVSATTFGTPVS
KMVTTNVTNPGPPVFLAGERVGSAGILLSWNTPPKPNGRIKSYVVKYKEVCPWMQATYTQ
VRAKPDSLEMLLTNLNPGTTYEIKVAAENIAGIGIFSEPFLFQTAESAPGKVVNLTVETF
NYSAVNLIWYLPRQPNGKITSFKISVKHARSGIIVKDVSIKVEDLLSGKLPECNENSESF
LWSTTRPSPTSGRATSPPRVTYMPNALAMSRKSSVWNEPISFVVTHLRPYTTYLFEVSAV
TTEAGYIDSTIVRTPESVPEDPPQNLATGNITENSFSLSWDPPSIVTGKFRYRVELYGPA
GLILNNSTKDLKFTFTNLTPYTTYYTYVGAETSAGMGPKSNLSIFTPPDVPSAVFDLQLL
EVEATLISITWKKPRQPNGIISQYRVQVFISETGIILEDTLLMGKDELMSDSMAPEKEVL
INAVTASYEGSAELFSNTAAESPVLFSSLSQNSISQANGNEDLYSTTGTASDQYFTDISA
EQLSYVVKRLVPFTEYTISVSAFTIMGEGPPTVLNARTSEQVPSSIQTINYKNISSSSIL
LYWDPPEYPNGKITHYTIYAMELDTNRAFQMTTVDNSFLITGLKKYTRYKMRVAASTNVG
ESSLSEENDVFVRTPEDEPESPPRGVEIMDVTPTEIKLKWLPPEKPNGIIMSYEVIYRNT
NHLFYKNASTTNIILNDLKPFTLYNISIRSYTRIGHGNQLSSLLSVRTSETVPDSAPENI
TYRNVSSGEIELSFLPPTIPNGIIQKYTIYLRRNNGYEERTINTTKLSQSIRGLKKYTHY
TVEVSASTLKGEGVRSTPVTILTEEDAPGSPPRDFSVKQLSGVTVKLSWQPPLEPNGIIL
YYTVYVWDKSSLKAINVTETSLEYANLENNIKYNAYVTASTRFGDGKMKSNLISFRTPEG
APSDPPKDVHYANLTSSSIILFWDPPSKPNGIIQYYSVYYQNNSGTFMQNFTLHDIVSFS
DNMTISAVIENLAIFSYYIVWVTASTSIGNGNKTSDIIQVYTDQDIPEGIVENLTYEPLS
STSINVSWFPPSQPNGLVFYYVSLSLQGNPRRTRPPLKTYERSLVFDNLKKYTDYIFKVT
PATEKGFSDLYTAQLHIKTEEDVPDSSPVINTFKNLSSTSVFISWDPPVQPNGAIISYDL
TLDGPNESYSFTTSENSVTLDELSPFTLYSFFAAARTIKGLGPSSTLFFYTDEAAPLAPP
QNLSIINCTSDSVWLTWNPSPLPSGVIKVYNIKIHENGTDSIFYQNISGFQTEAKIIGLE
PITAYSVSVSAFTRVGNGNHFSNIVLFMTQESVPDVVQNLHCTATSWQSIVLKWDPPKKA
NGIITHYTITIERNSTKIASQEHTHYFKELVSNTSYVFKIQASTSAGEGEEEICNASTLH
ETVPSAPRNITLSDVQSTSVTLTWAIPDAILGYFQNYKITMQLRSPQCSSWDPEECIEQN
QNHYLYEPDLLEETIHGLKKFRWYRFQVAASTNAGYGNTSNWISTKTLPGPPDGPPENVN
VVATSPYSINISWNEPAAITGPTFYLIDIKSVDSDEYNISFIKANEENKTIEITDLKVFT
RYSVIITAFTGNISSAYVDGKASAQVIVTTLESVPKDPPNNMTFQKIPDEVTKFQLTFLP
PSEPNGNIRVYQALVYREDDPTAFQIHNLSIIQKTDTSVIAMLEGLKGGHTYNISVYAVN
GAGAGPKAQMRITMDIKAPARPKNKPIPVYDATGAVLVTSKTITIRMPICYYNDDHGPIK
NVQVLVSETGAQHDINITKWYDAYYKKPRPYFANEGFPNPPCTDGKLQLSSLDDVYVIGA
DNTCLIPGNEDKICNGPLKPRKQYVFKFRATNIMGQFTDSDYSDPVKTLGEGLSERTVEI
ILSVTLCILSIVLLVAAIFAFARIRQKQKEGGTYSPRDAEIIDTKFKLDQFITVADLELK
DERLTRPISKKAFLQHVEELCTNNNLKFEEEFSELPKFLQDLSSTDADLPWNRAKNRFPN
IKPYNNNRVKLIADASVPGSDYINASYVSGYLCPNEFIATQGPLPGTVGDFWRMVWETRA
KTLVMLTQCFEKGRIRCHQYWPEDNKPVTVFGDIVITKVLEDIQIDWTIRDLKIERHGDC
MTVRQCNFTAWPEHGVPENSAPLIHFVKLIRASRAHDTTPMVVHCSAGVGRTGVFIALDH
LTQHINDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSSKGSHQPICFVNYS
ALQKMDSLDAMEGDVELEWEETTM
Download sequence
Identical sequences F7FIY2
ENSMODP00000025624 ENSMODP00000025624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]