SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025701 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025701
Domain Number 1 Region: 91-172
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000582
Family I set domains 0.0097
Further Details:      
 
Domain Number 2 Region: 974-1055
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000782
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 622-703
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000148
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 795-875
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000222
Family I set domains 0.0094
Further Details:      
 
Domain Number 5 Region: 264-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000419
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 440-521
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000348
Family I set domains 0.031
Further Details:      
 
Domain Number 7 Region: 155-270
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000454
Family I set domains 0.012
Further Details:      
 
Domain Number 8 Region: 362-450
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000487
Family I set domains 0.022
Further Details:      
 
Domain Number 9 Region: 715-802
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000757
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 891-978
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000199
Family I set domains 0.011
Further Details:      
 
Domain Number 11 Region: 539-626
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000579
Family I set domains 0.013
Further Details:      
 
Domain Number 12 Region: 11-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000112
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025701   Gene: ENSMODG00000028170   Transcript: ENSMODT00000026159
Sequence length 1074
Comment pep:novel chromosome:BROADO5:Un:40105851:40161911:1 gene:ENSMODG00000028170 transcript:ENSMODT00000026159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYAPLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAGLRIQLSPDRRTL
TLSSLTRSVNKGPYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSPNEYPPGANITLSC
VADSNPAAQFSWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYA
PLSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSPDKRTLTVSR
LTRRDNKGPYECEIRNPFFSNRSHPFTLDVAYGPDIATIDNISDQFATGINVTLSCVADS
NPPAQFTWLQNGQSVSNSASFSIITSLNDIGNYTCIATNSFTGLTRTANKTLMIYAPLSK
PTIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVATAGSRIQLSPDKRTLTLSRLTRR
DNKGPYECEIRNPFYSNRSHPFTLDVAYGPDIATIDHIRDQFATGINVTLSCVADSNPPA
QFTWLQNGQPVSNSASFSIITSLNVIGNYTCIATNSFTGLTRTANKTLMIYAPLSKPTIL
TSNNTAVETKDFSMTCNAMGQIHTYLWFLNGLAPGGNRIQLSPDRRTLTIRSLTRFDNKG
PYVCEIENPLFRNRSDPFPLNVTYGPDIATIVHSADEYPPGANITLSCVADSNPAAQFTW
LHNGQPVSKSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYAPLSKPTIITSNN
TAVETKDFSMTCNATGQIPAYRWFINGLAPGGNRIQLSPDKRTLTIRSLRRTENKGPYVC
EIENPLFRNRSDPFTLDVAYGPDIATIVHSANEYPTGANITLSCVADSNPAAQFTWLQNG
QRISNSATFSVIASLSDAGTYTCTASNLFTGLTRTATKNITIYAPLSKPTIVTSNNTAVE
TKDFSLTCQATGQIHAYRWFINGLAPSGSRIQLSPDKKILTIGNLTRRENKGPYVCEIEN
PLFRNRSDPFTLDVAYGPDITTIVHSADEYTTGANITLSCVADSNPAAQFTWLHNGQPVS
NSATFSIIASLSDAGTYTCTVSNSFTGLTRTATKNIIIYGEYLDWAPNFVWGSL
Download sequence
Identical sequences M9MMI6
ENSMODP00000027201 ENSMODP00000025701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]