SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025791 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025791
Domain Number 1 Region: 856-1104
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-78
Family Eukaryotic proteases 0.0000592
Further Details:      
 
Domain Number 2 Region: 522-643
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.96e-35
Family Frizzled cysteine-rich domain 0.00013
Further Details:      
 
Domain Number 3 Region: 206-321
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.35e-31
Family Frizzled cysteine-rich domain 0.00065
Further Details:      
 
Domain Number 4 Region: 649-686
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 373-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 452-493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 338-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 723-762
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 757-860
Classification Level Classification E-value
Superfamily SRCR-like 0.00000194
Family Scavenger receptor cysteine-rich (SRCR) domain 0.07
Further Details:      
 
Domain Number 11 Region: 689-721
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025791   Gene: ENSMODG00000020619   Transcript: ENSMODT00000026252
Sequence length 1111
Comment pep:novel chromosome:BROADO5:5:175287901:175512161:1 gene:ENSMODG00000020619 transcript:ENSMODT00000026252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSMKQFSALPPEERYRQVLAQPERVLVADEGSMGGSCSQKLASAKYLRLLLLILIPCIC
ALILLLVILLTFVGSLEKKDFSSNGSDLLVTDDGIQKADVLPTTMIHNISAVMSTVNPSQ
QTPASWTLYPSQGDQMNKNISKSEDSTFEKPFTSVQPTDDKSQSLTSTTEESVWPVQSSS
KLPDWTPSTLSPSRSTVVSEMDMKKGACVNIVNSQCQMLPYNHTTLTSILSIVKRIEMEK
FLKFFSYLNRLNCYQHIMLFGCSMAFPECISDGDDSHGLLPCRSFCEIAKEGCEPVLGMV
NSSWPEFLKCSQFRNHSESDIRRVCFSPQQERGKQLLCGGGESFLCASGVCIPRKLQCNG
FNDCDDWSDERLCNCSEGLFHCHTGKCLNYSFVCDGYNDCGDLSDEQNCDCNPMKEHRCG
DGRCITMDWVCDGDHDCLDKSDEVNCSCYSQGLLECGNGQCIPSVFRCDGDEDCKDGSDE
ENCSNTQITCLEGDQKCIYNSCFDACGGSSLCDSDNNQTTCSQCEPITLELCLNLPYNYT
SFPNYLGHRTQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDPHTNQHIPPCRT
LCEHSKERCESVLGIVGLQWPEDTDCTQFPEESSENQTCLMPDEDVEECSPSHFKCRSGR
CILASRRCDGQADCEDDSDEEHCGCKERGLWECPVSKLCIKHEVICDGFPDCPDNMDENN
CSSCQDDELECANHDCVSRDLWCDGGVDCLDGSDEWDCVTLSKDANSSTFLTVHRSATDY
QVCADNWQETLSQLACKQMGLGELSVTEMIQVQRHPWKWLTLRLDWQHINTSTLHQLLVK
GHPCQSRSRISLLCSEQDCGRRPAARMYKRILGGRTSRPGRWPWQCSLQSEPSGHICGCV
LIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSIFMQTRLVKTIILHPRYNRAVVDY
DISIVELNEDINETSYVRPVCLPSSEQVVEPDTYCYITGWGHMGNKMPFKLQEGEVRIIS
LEQCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCERPGGQWTLFGLTSWGSVCF
SKVLGPGVYSNVSHFVEWIQRQIYIHTFLVN
Download sequence
Identical sequences F6ZAT4
ENSMODP00000025791 XP_007496546.1.35504 ENSMODP00000025791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]