SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025859 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025859
Domain Number 1 Region: 564-698,774-945
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.45e-78
Family Protein kinases, catalytic subunit 0.0000000107
Further Details:      
 
Domain Number 2 Region: 319-415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000186
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 219-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000539
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 
Domain Number 4 Region: 35-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000914
Family C1 set domains (antibody constant domain-like) 0.056
Further Details:      
 
Domain Number 5 Region: 117-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000369
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025859
Domain Number - Region: 433-450,482-514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00598
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025859   Gene: ENSMODG00000020670   Transcript: ENSMODT00000026321
Sequence length 1085
Comment pep:novel chromosome:BROADO5:5:171557576:171604856:-1 gene:ENSMODG00000020670 transcript:ENSMODT00000026321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSPWALLVLGCLLTGPWLAFCQLPLPTVFPNEDEKVVQLHSSFTLRCSGDSEVSWQYP
MQDEEDHKIEVRNEENNSGLFVTVLEVVNASAVHTGLYTCYYNHTQTEETEIEGRDIYIY
VPDPDVAFVPSVMVDHLIFAEEHDSVTIPCRTTDPLAQVTLLNSDNKVVHAFYDSRQGFI
GNFAMGQFKCETTIKGKTFQTVPFNIYTITATPELEVEIEAEKTVYKTGETLVVTCAVLH
NEVVDLQWNYPGKVKNKGILKVDEIKVPSLKLVYTLTVPKVTVKDSGDYECAARHATKET
KKIKKVTISVHEKGFIELNPNFRQSEAINLHEVRHFVVDVQAYPPPKISWLKDNMTVIEN
LTEIITGLDKIQEIRYQSKLKLIRAKEEDSGNYTIMAQNEDDIKNYTFQLIIQVPASILD
LEDDNHGSAGGQTVKCMAEGTPLPVVEWMVCKDITKCNNETSWTHLASNTSDITEKQDSS
MVESQVTFNKIEDTMAVRCLARNLLGSVTRELKLVAPAMRSELTVAASVLVLLVIVIFSL
IILIVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSG
AFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLG
ACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSHHPEKTKKELDIFGMNSADESTRSYVI
LSFENNGDYMDMKQADTTQYVPMLERKQGSKYSDIQRSMYDRPASYKKKSVSDPEVKNLL
SDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARD
IMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVD
STFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSY
EKIHLDFLKSDHPAVARMRVDCDNTYIGVTYKNEDQMKDWEGSYDEQRLSADSGYIIPLP
DIDPIPEDDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDPSDLI
EDSFL
Download sequence
Identical sequences F7E5I9
XP_001363229.1.35504 XP_007496512.1.35504 XP_007496513.1.35504 ENSMODP00000025859 13616.ENSMODP00000025859 ENSMODP00000025859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]