SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025863 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025863
Domain Number 1 Region: 809-936,981-1155
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-78
Family Protein kinases, catalytic subunit 0.00000000016
Further Details:      
 
Domain Number 2 Region: 655-749
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-20
Family I set domains 0.0085
Further Details:      
 
Domain Number 3 Region: 333-446
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000228
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 5 Region: 427-454,487-539
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000288
Family I set domains 0.079
Further Details:      
 
Domain Number 6 Region: 556-656
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000414
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Domain Number 7 Region: 31-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000517
Family V set domains (antibody variable domain-like) 0.098
Further Details:      
 
Domain Number 8 Region: 113-216
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000966
Family I set domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025863   Gene: ENSMODG00000020673   Transcript: ENSMODT00000026325
Sequence length 1349
Comment pep:novel chromosome:BROADO5:5:170630458:170681684:1 gene:ENSMODG00000020673 transcript:ENSMODT00000026325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAPMLLVFWWLIGKSQLVSGLPIASPDTPVISPQKDILTITANSSLQITCRGQRDLDW
LWPNNQSTSDNRVVVTDCWDGPFCKMLTITKVIGNDTGAYKCLYQDNDVSSSIYVYVQDY
RSPFISSVSDQHGVIYITENKNKTVIIPCLGSIANLNVSLYAKYPEKKFVPDGEKIFWDS
KIGFTLPSYMISYAGMVFCEAKINDESYQSLMYIVVVVGYRIYELALSPPHSVELAVGEK
LVLNCTARTELNVGIHFRWESPSLKPEIRDLKAPFGSELKKFLSTLTIEHVTRSDQGWYI
CEASSGLMTKKNSTYVTVHEKPFVAFHSGMESLVEAKLGERVRIPVKYVGYPPPEIKWYK
HGKAIESNHTVKVGHALTITEASEKDAGNYTVLLTNPITKARQSHVVSLVVNVPPQIGEK
SLIAPVDSYHYGSMQTLTCTVYAVPPPLDIQWYWQLEEACTYNPGQAGLVTNPYTCREWK
NMEDLTGGNPIEIVKNQFVIIDEKNKTVSTLVIQAANVSSLYKCEAINKVGRSERIISFH
VTRGLEINFQPGNQPTEQENVSLWCTAEKSTFENLTWYKISPRASQDHLGELPMPVCKSL
DALLKMNATMISNSTSDIVILELQNISLQDQGDYVCLAQDKKTKKRHCVVRHLTVQERVA
PMIAGNLENQTTNIGETIEVSCPASGIPLPQITWFKDNETLVEDSGIILKDGNRNLTIRR
VRKEDGGLYTCHACNVLGCTKAETLIIVEGAQEKTNLELIILVGTAVIAMFFWLLLVIIL
RTIKRANGGELKTGYLSIIMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFG
QVLEADAFGIDKTATCSTVAVKMLKEGATQSEHRALMSELKILIHIGHHLNVVNLLGACT
KPGGPLMVIVEYCKFGNLSTYLRSKRDEFVPYKTKSSRFRQGKDNYVGEIPVDPKRRLDS
ITSSQSSASSGFVEEKSLSDVEEEEAAEDLCKNPLSLEHLICYSFQVAKGMEFLASRKCI
HRDLAARNILLAEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQ
SDVWSFGILLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPEYTTPEMYQTMLDCWHG
EPKQRPTFSELVEHLGNLLQASAQQDGKDYIVLPISESLSMEEDSGLSLPTSPVSCMEEE
EVCDPKFHYDNTAGISQYLQSSKRKSRSVSVKTFEDIPLEPQIKVIPDDNQTDSGMVLAS
EELKTLEDRSKLATPFSALMPSKSKESVTSEASNQTSGYQSGYHSDDTDTPVYLSEETEL
LNPGESEPQSCNVQTLQPDSWMPLNSPPV
Download sequence
Identical sequences F7DLA5
XP_007496509.1.35504 ENSMODP00000025863 ENSMODP00000025863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]