SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025900 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025900
Domain Number 1 Region: 165-270
Classification Level Classification E-value
Superfamily Immunoglobulin 2.21e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 36-129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000345
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 109-162
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000139
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025900   Gene: ENSMODG00000020706   Transcript: ENSMODT00000026362
Sequence length 287
Comment pep:novel chromosome:BROADO5:5:168559854:168649818:1 gene:ENSMODG00000020706 transcript:ENSMODT00000026362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPLLRLLLLCAPGLLLLLLPLSSSSSSEAGEPAACGPCEPAACPPLPPRGCPLGETRD
ACGCCPACARGEGEPCGGSGAGRGHCAPGMECVKSRKRRKGKAGAAAGGPVVSGVCVCKS
RYPVCGSDGKTYPSGCQLRAASLRAESLGEKTITQVSKGTCDQGPSIVTPPKDIWNVTGA
QVYLSCEVIGIPTPVLIWNKVKRGHFGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLV
SPLSKEDAGEYECHASNSQGQATASAKITVVNALHEIPTKKEEGADL
Download sequence
Identical sequences F7BB01
XP_001369840.1.35504 ENSMODP00000025900 ENSMODP00000025900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]