SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025928 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025928
Domain Number 1 Region: 682-960
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-84
Family Protein kinases, catalytic subunit 0.000000000834
Further Details:      
 
Domain Number 2 Region: 72-244
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-71
Family Ephrin receptor ligand binding domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 369-572
Classification Level Classification E-value
Superfamily Fibronectin type III 2.78e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 978-1045
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.43e-21
Family SAM (sterile alpha motif) domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025928
Domain Number - Region: 300-371,407-421
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000112
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025928   Gene: ENSMODG00000020730   Transcript: ENSMODT00000026392
Sequence length 1050
Comment pep:novel chromosome:BROADO5:5:158217527:158724608:1 gene:ENSMODG00000020730 transcript:ENSMODT00000026392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGYEPRAAGRRRRRLSSGCGEVGHGGGGNCNSSSTTASLAGCCSAPKRAPLWTCLLLCA
ALRTLLASPSNEVNLLDSRTVMGDLGWIAYPKNGWEEIGEVDENYAPIHTYQVCKVMEQS
QNNWLLTSWISNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDNEDGRNIKE
NQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLTKKGFYLAFQDVGACIALVSVRV
YYKKCPSVVRNLALFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGK
CMCKAGYEEKNGTCQVCKPGFFKASPQSQSCSKCPPHSYTHEEASTSCLCEKDYFRRESD
PPTMACTRPPSAPRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEEC
GGHVRYLPRQIGLKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAA
PSPVTNVKKGKIAKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAD
GLKPASVYVFQIRARTAAGYGVFSRRFEFETIPVSIAASSDQSQIPIIAVSVTVGVILLA
VVIGFLLSGSCCECGCDRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGV
RTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKREFPVAIK
TLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKK
NDGQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLED
DPEAAYTTRGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDV
IKAVEEGYRLPSPMDCPAALYQLMLDCWQKDRNSRPKFDEIVSMLDKLIRNPSSLKTLVN
ASSRVSNLLAEHGPLGTGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRR
LGVTLVGHQKKIMNSLQEMKVQLVNGMVPL
Download sequence
Identical sequences F7ANR2
ENSMODP00000025928 XP_001368028.1.35504 ENSMODP00000025928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]