SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025947 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025947
Domain Number 1 Region: 163-416
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-81
Family Eukaryotic proteases 0.00035
Further Details:      
 
Domain Number 2 Region: 37-162
Classification Level Classification E-value
Superfamily SEA domain 7.72e-16
Family SEA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025947   Gene: ENSMODG00000020746   Transcript: ENSMODT00000026411
Sequence length 417
Comment pep:novel chromosome:BROADO5:5:155517511:155567365:1 gene:ENSMODG00000020746 transcript:ENSMODT00000026411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFRSRGVGTKTRGLEPWMIVLIVIVGLLIASITIGLLVHFLVFDQRLEYYHGTFKISDAQ
LNANAEQGYGYQYKNLRERSEILVDETFMDSILSKHYIKNQVIQLTPEIDGVKADVVMIF
QFPTKERRETREKKIHSILNQKIRATRALKINASSLQLNAMSSTTGKLTVQSCCGKRVAP
TIINRIIGGEIAPKSAWPWQASLQHDNVHQCGGTLISNTWLITAAHCFKNYPSPRGWTIS
FGITIDPPLMKRNIRKIIVHERYRSPAREYDIAVVQFSPKVTFTDDIRRICLPEASDHFP
SNSTLFITGFGALNYGGISQNQLRQASVDIISDEACRQPHVYGKEITFGMFCAGFLEGIY
DACRGDSGGPLVVKDYKDTWYLLGIVSWGDNCGRVNKPGVYTQITYYRKWITSKTGL
Download sequence
Identical sequences F6ZZX9
ENSMODP00000025947 ENSMODP00000025947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]