SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025952 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025952
Domain Number 1 Region: 186-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.68e-82
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 40-163
Classification Level Classification E-value
Superfamily SEA domain 2.88e-22
Family SEA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025952   Gene: ENSMODG00000020751   Transcript: ENSMODT00000026416
Sequence length 423
Comment pep:novel chromosome:BROADO5:5:155178084:155198410:1 gene:ENSMODG00000020751 transcript:ENSMODT00000026416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLFHSTGIASQRRSLPLWMIALVLLGILVILGVTIGLLVHFLAVEKTHYYQASFNVSGA
SHNYDCGKRASLESRALIKNLENVMSDAFHNSSIYREYILSQVIRLSSGPRGVTAKILLA
FKFSLAKKDNMWRSLRSILHQMLKDNKESLLTDPSSLKFMEISKDDAENLVINCCGRRLS
LISDDLIKGNNRIKGGGPSKEGEWPWQASLKWNGKHHCGASLISKSWLVSAAHCFVRSND
TTKWTVTFGNMVNHPYMKRNVKTIIVHEDYQIRLKDDIALVQLTEEVTLTKDVRSICLPD
ATQNFSAGDRAIVTGWGKFYMNGPHPEILHQATVQIIDTDICNAPQAYNGSITDSMLCAG
YMSGKADACKDDSGGPLVSLDPTGIWYLIGIVSWGDGCGKVNKPGIYTKVTFYRDWIANK
TGI
Download sequence
Identical sequences F6ZZE4
ENSMODP00000025952 ENSMODP00000025952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]