SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026007 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026007
Domain Number 1 Region: 106-185
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000479
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 21-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000002
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026007   Gene: ENSMODG00000027901   Transcript: ENSMODT00000026472
Sequence length 208
Comment pep:novel chromosome:BROADO5:Un:81895256:81896422:1 gene:ENSMODG00000027901 transcript:ENSMODT00000026472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNQHSHFLSILCTAPLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAGLR
IQLSPDRRTLTLRSLTRSDNKGPYVCEIKNPFYRNRSDPFTLDVAYGPDNATIVHSANEY
RTGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTVSNSFTGLTR
TATKNIIIYGEYLDWAPQLCVGLSLSVP
Download sequence
Identical sequences M9MMI2
ENSMODP00000026007 ENSMODP00000026007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]