SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026018 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026018
Domain Number 1 Region: 572-662
Classification Level Classification E-value
Superfamily Immunoglobulin 2.59e-22
Family I set domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026018   Gene: ENSMODG00000020802   Transcript: ENSMODT00000026483
Sequence length 666
Comment pep:novel chromosome:BROADO5:Un:4019514:4036345:1 gene:ENSMODG00000020802 transcript:ENSMODT00000026483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDVSQKAEILLSSSKPVPKTYVPKLGQGDVKDKFEAMQKAREERNQRRSRDEKQRRKEQ
FLREREWNRRKQEMKEMLASDDDDDDEATTKAEKAYVPKLTGTVKGKFAEMEKQRQEEQR
KRTEEERKRRIEQDLLEKRKIQRELAKRAQQMEDRNAVGPESAAEEGDASLLVTVVPGRA
HKTAGNVQKAFEDLERASGEEQRVLKEAMCLSLVMDEEAEDVAGAKGSPSPGRLKFTFEE
MEKERQETRKRQAAEEARQRLQEERRAFEEARQQMAGEGGEDGCGMQTCPRERLGPGKLR
LSFEGLERQRREEEKRRAQEEGQRRREEEKRAFAEARKSMVLDADSEELHRPGSLESLPP
GKLEMNFEELLKQKMEEEKRRTEEERKHRLEMEKQAFAQLRQEMGQEEEESEIFEPSREY
EELMKLKRSGSIQAKTLRSKFERIGQVSEEEIQKKVEEERARRRAADLEIKEREAEHFHE
EDDVDVKPAQKCEAPFTHKVNMKARFEQMAKAREEEEQRRIEQQKLLRMQFEQEEIDAAL
QKKKEDAAEEEGGTGKGCALEDGDEQARSGAPWFRKPLRNTTVVDGEPVRFTVKVTGDPK
PAVTWWFEGERLEDGEDYQYIERGDTYCLYLPETFPEDQGEYMCHAANGRGTAASTCILT
IETDDY
Download sequence
Identical sequences H9H7N0
ENSMODP00000026018 XP_001380901.3.35504 ENSMODP00000026018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]