SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026035 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026035
Domain Number 1 Region: 152-243
Classification Level Classification E-value
Superfamily Immunoglobulin 3.74e-20
Family I set domains 0.084
Further Details:      
 
Domain Number 2 Region: 274-353
Classification Level Classification E-value
Superfamily Immunoglobulin 6.41e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 42-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000349
Family V set domains (antibody variable domain-like) 0.0017
Further Details:      
 
Domain Number 4 Region: 351-441
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000666
Family I set domains 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026035   Gene: ENSMODG00000023803   Transcript: ENSMODT00000026500
Sequence length 571
Comment pep:novel chromosome:BROADO5:4:377531232:377550910:-1 gene:ENSMODG00000023803 transcript:ENSMODT00000026500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLKEPPGWSLDPSSNFASLGMLVFRLLLPIVYGEKAEFSLKVLENVTVQENLCVQIPC
TFSYGRKNASQGQIFLFWHLDGKNKTVATNKPNVTIPAKFQGRFSIIGNPQNYNCSLFIM
NAQKTDKGKYSLKVKKGKSTHDFGNKVSVKVLEMTQKPEIQIPETLDSGHPVTLTCKMPG
ACEGENSPTFLWTGSALSSLSPGTRTHASSELTFTPRPQDHGTNLTCQVTFKEPYVSSEE
TVQLRVTYPPKEITIQVFHGNWTGAPGNALYLPILEGESLSLSCAADSNPATSLKWTKGR
QTLNSSQPSSAGVVALQLHQVGPRDSGEYICQTQDPLGSQKASLMLSVQYPPKLLSSSCS
WTEEGLLCNCSVQAEPAPSLLWWLGEKIMQGNNSDTLWKVSTTSGVWINSSLNLKEKLDP
ALSLRCEGRNRHGTHSLSIVLLPDRTSPDTELNMKPLIMGAACGACVTGLLALGVIIVVK
TLKKKSAEMRTNTSRAEANVGDRHPSSEAIPLDPNRMLRSSPCDTVKSTSEEEPQLHYAC
LNFQRLRPQEPQESAYTGTEYAELKFQKQPL
Download sequence
Identical sequences F6RN11
ENSMODP00000026035 ENSMODP00000026035 XP_007491761.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]