SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026040 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026040
Domain Number 1 Region: 140-228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-20
Family C2 set domains 0.05
Further Details:      
 
Domain Number 2 Region: 19-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000456
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026040   Gene: ENSMODG00000020820   Transcript: ENSMODT00000026505
Sequence length 236
Comment pep:novel chromosome:BROADO5:4:377682365:377683536:1 gene:ENSMODG00000020820 transcript:ENSMODT00000026505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLLPIGSFSQEQPVFGLHVQKKVTVQKGLCVSIPCSFYYPPKFRNNDTAHGYWYWKKSQ
DEPRATNEDPVATNDPQKATQPWAQGRFYLIGDPQMDNCSLSITGAQKRDRGHYEFRVEK
GKLRYSFTNDRVLIQVETLTQKPEIHMPEILEPGHQVALTCLVPGDCRNGTSASFLWTGN
ALSSQQVTSSNRSSSRLLFTPQRQDNGTNLTCQVKFPEGRVNTKRTVQLRIAGEFG
Download sequence
Identical sequences F6RM72
ENSMODP00000026040 ENSMODP00000026040 13616.ENSMODP00000026040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]