SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026046 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026046
Domain Number 1 Region: 360-449
Classification Level Classification E-value
Superfamily Immunoglobulin 5.54e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 24-142
Classification Level Classification E-value
Superfamily Immunoglobulin 5.29e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 145-232
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-18
Family I set domains 0.042
Further Details:      
 
Domain Number 4 Region: 261-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000039
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026046
Domain Number - Region: 446-536
Classification Level Classification E-value
Superfamily Immunoglobulin 0.096
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026046   Gene: ENSMODG00000020825   Transcript: ENSMODT00000026511
Sequence length 649
Comment pep:novel chromosome:BROADO5:4:377859304:377870204:-1 gene:ENSMODG00000020825 transcript:ENSMODT00000026511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLLSSFGGSQSQKEGYKLQVSQSVAVQEGLCAYIPCTFFYPFHEKWVSPSNIHG
YWFKDGPNLSEDDPMATNDQMRKVNEEAGGRFHLIGDPVKDKCSLSIVDVQMRDSGQYFF
RMKRGKDEKFNYLSYKVHLNVEVLTEKPDIYMPEILEPERSVTLLCAAPWICGNATPPIF
FWAGTAISNLRQSQGTPYFSELTFTPRSQDHGTNLTCRVTFPGAGVSTETTIPLNVAYSL
KNFGISAAWEKRTGLESSSDLSSLSIQKDKSLRLFCQADSNPPAMLSWVHGGQVVLSSWP
SGAGVLALELPRLGIEDGGEYRCQAQHQKETQHVSLNLSILYAPEDLKVSVLGPNRTVTI
LGNASSLVILVGETLHLECVADSRPLANMTWAKGSQLLSSSLLSSPGVVGLELSHVQPED
EGKYTCQAQNPWGTQHTSLNLSVQYPPKLYNPFCSRTDEGLFCTCCIQAKPISSLIWRVG
ESTVEGNSNNDTLQVMSITSGSWTNSSLILKEKLGLDLNLHCEGRNQHGAHSLVILLVAD
ASGAAALTFSKGVFLGVAIMALLFVCLKYALKKLQRKKQVEMRDLGTTDSQSNKEVDYEN
LDMNWSRGTRQSSPDPVTQTPPEELHYASLNFRRLKPQDNRENQEENKK
Download sequence
Identical sequences F6RM18
ENSMODP00000026046 XP_007491776.1.35504 ENSMODP00000026046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]