SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026057 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026057
Domain Number 1 Region: 224-316
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 124-231
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-17
Family I set domains 0.071
Further Details:      
 
Domain Number 3 Region: 28-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000963
Family V set domains (antibody variable domain-like) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026057   Gene: ENSMODG00000020835   Transcript: ENSMODT00000026522
Sequence length 396
Comment pep:novel chromosome:BROADO5:4:378489532:378495741:1 gene:ENSMODG00000020835 transcript:ENSMODT00000026522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDWGANGVGPRWGMEVLSMPTGSAQGVQTENVTVAEGGVAEITCRLHQYDGSIVVLQNPA
RQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLDDEGGYFCQLYTEDTHHQIATLTV
LVAPENPIVEGREQAVEGGEVELSCVVPRSRPPAMLRWYRDRKELRGQRKQKERVDSRQE
NGKVWSVASTVRFQVDRKDDGGIVTCEAQNAALPPGHSKQTQYVLDVQYSPTARIHASQA
VVREGDTLVLTCAVTGNPRPGQIRWSRGNESLPERAEAVGETLTLPGLTSLDNGTYTCEA
GNKHGQARALYVLVVYADPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVRQK
GSYLTHEASGLDEQGEAREAFLNGGDGHKRKEEFFI
Download sequence
Identical sequences F6RL68
ENSMODP00000026057 ENSMODP00000026057 13616.ENSMODP00000026057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]