SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026063 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026063
Domain Number 1 Region: 1045-1172,1220-1393
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.9e-76
Family Protein kinases, catalytic subunit 0.000000000834
Further Details:      
 
Domain Number 2 Region: 897-985
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-19
Family I set domains 0.0086
Further Details:      
 
Domain Number 3 Region: 594-675
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000579
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 662-799
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000106
Family I set domains 0.093
Further Details:      
 
Domain Number 5 Region: 804-882
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000248
Family I set domains 0.038
Further Details:      
 
Domain Number 6 Region: 482-574
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000335
Family I set domains 0.073
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026063
Domain Number - Region: 284-376
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00387
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026063   Gene: ENSMODG00000020842   Transcript: ENSMODT00000026528
Sequence length 1569
Comment pep:novel chromosome:BROADO5:X:26626197:26780872:-1 gene:ENSMODG00000020842 transcript:ENSMODT00000026528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMGPGVSGGCSHFPNKKLRLLSRSSFPSSPSTHTHSQTQTAPSLPVAFFGALRPPWGYS
GEQQWPGRPLRRGHCGLPPAGSSRLCPTRSERTAPRPLTCPLPPILPSTLPPPPAPPPPG
PRGLSVALSVGRTPGPHPLPPLCSEQPLVPVRLSSVLSGPVPRQPLSDPQPSLQSRHLRQ
PARATGSAATPAPPRPRAAAPRRATGSPSEPGRERASERSLPCAARPKMLPPPPPPRARR
AALPALRLRLLLLLLLPPAGLCVPDLTIKEESLIKPELSFLGDQVVIPAGSPFDVTCRGS
APLVWHWSNSSSSGSVRIAERPCPDDALLSCSQLTIFSTVASETGYFTCSYRDVSDSEDP
SFMTRVYVYVKDDNQPFVERYYDEPLVITVFSGAQEVIVPCRVTSPDLNVKLALFTSAKF
NYTRKDWNPQKGFTVIRPSFQFFSSLLQCVTTVNGKTHISLYLPQKVETRRENISIRVNQ
RKLLAGETLSLSCMAETTYNGRIKLDWEYNRKENKANPRCCEIRKNMDQRTPVYKIYSNL
TIWNVSTEDSGLYRCQEGNGSSIQASVNITVLEKAYINVTYRRNVAYEVIAGHSSQKLSV
RVDAFPRPNVTWYKDGQLILDNLTYHSDPLRYRLTIMNVKVKHSGNYTIVLSNTKHGLYE
SRTIQLLVYERPKIFEKETDLNKTQPVFLGSEHVLHCTASGVPPPTFHWAWEPCVSGDAL
CQERGKRVELSEATLAQGRYPTSQVQSIEEMVIRRGDRNQTLSMLTIASSTISGVYFCIA
CNRVGRDERVMKVYVSDVPGHLETHRQVLAIEGHDAQLTCRVARYVYDGLAWFNPFGQRV
PASSTERRVNKYSISLTLLIRNVSHQHGGHYKCKAWNQRNTTAVLERSAWLLTREKVAPF
VIENLTDLVVNSSGKIVLQCKVGGTPTPGITWLKNGNAILPASGISLENNTLVIERAKKD
DEGIYKCKATNEKGQVSTSALITVAGSEERSSVEVIILVCTGLAATLFWLLLTLVIRKLR
KPNAPDIKTGYLSIIMDPEEVPLDQQCDQLPYDSSKWEFPRDRLRLGKTLGHGAFGKVVE
ASAFGIDKSSTCKTVAVKMLKECATSNECKALMSELKILIHIGHHLNVVNLLGACTKPGG
PLMVIVEFCKYGNLSNFLRGKRGDFVAYKTQDSSEQGEKKAEDSDCDLTELIKRRLESVA
STGSSASSGFIEDKTYSDSEDEEEDSEDVSKRPLTLEDLICYSYQVAKGMEFLASRKCIH
RDLAARNILLTDNNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPEAIFDKIYTTQS
DVWSFGVLLWEIFSLGASPYPGVQIDEDFCLRLKEGSRMKSPEYSTAEIYETMLDCWNGE
CAERPTFTELVERLGDLLQASVQQEGKDYIPLNVMDKELDFEASPMDENLSNGPKFPNTK
EDSINGLQMPPLSTKTSSEGSVEPKKMRPEDNKAEIRMELPPVKRLETRSWPYGLMALAL
RATSRSKESVLLSEEKEALKPQPPDQLDEDDPLAFALEDSVLLPLDPGLECHSPPPDYNS
VVHYSDSLV
Download sequence
Identical sequences F6R1G7
ENSMODP00000026063 ENSMODP00000026063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]