SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026073 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026073
Domain Number 1 Region: 125-251
Classification Level Classification E-value
Superfamily SEA domain 2.62e-41
Family SEA domain 0.00023
Further Details:      
 
Domain Number 2 Region: 599-720
Classification Level Classification E-value
Superfamily SEA domain 3.66e-40
Family SEA domain 0.00025
Further Details:      
 
Domain Number 3 Region: 729-846
Classification Level Classification E-value
Superfamily SEA domain 1.31e-36
Family SEA domain 0.00044
Further Details:      
 
Domain Number 4 Region: 443-562
Classification Level Classification E-value
Superfamily SEA domain 2.48e-36
Family SEA domain 0.00036
Further Details:      
 
Domain Number 5 Region: 283-402
Classification Level Classification E-value
Superfamily SEA domain 4.84e-36
Family SEA domain 0.00049
Further Details:      
 
Domain Number 6 Region: 1-100
Classification Level Classification E-value
Superfamily SEA domain 3.27e-29
Family SEA domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026073   Gene: ENSMODG00000020848   Transcript: ENSMODT00000026538
Sequence length 846
Comment pep:novel chromosome:BROADO5:3:481761076:482051720:1 gene:ENSMODG00000020848 transcript:ENSMODT00000026538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQRGSSKFNSIEDVLQPLINNLFRKSSFGPHYFGCRLTLLRSMKNRIATGVDVECAYQE
DSSTPVLDREKIYWELSEQTHGKTRLGPYILHKESLYVDGEKYVQSNWFLCFVFHPHLQP
SCLPPAWRPSLEAFTLNFTITNLLYTEDMGQKDSIKFKSTEKILQNMLGPLFENSSLGSS
YSRCKLTFLRPLKNLTVTEIGVICLYQSDSTGPFLDRERVYWEFSNQTGGITRLGPYTLD
RDSLYLNGYNHHLQSSTCSKYSSTSCLYLSSCFSAPPTVSGSFSLESFTLNFTINNLLCT
ADMGRPGSQKFNATERVLQRLLSPLLENSSLGSDYSGCRLTMLRPMKEGRATLVHFTCIH
RRDPSSPVLDREKIYCELSYLTWSITRLGPYTLEKDSLYLNGNFYVSVSGVPVIILAITT
TVHLSWHDGTISPGGSPSCPLLVLIFTLDFTITNMLYKPEMGETGSSTFEAIEHVLKNLF
KVLFERSSLGSQYSGCSVTLLRSMNNGKATGVEVICCYQEVLSIPVLDKKKIYQELSQQT
NGITKLGSYILDNESLYVDGETHSSSPPVTSSERNTHVTLTTSKSPPLEKFWAPSSLFHV
LEAFTLNFTITNLLYTEDMGQKDSIKFKSTEKILQNMLGPLFENSSLGSSYSRCKLTFLR
PLKNLTVTEVGVTCLYQSDFTGPFLDRERVYWEFSNQTGGITRLGPYTLDRDSLFLNGFS
APPTASGSFSLKSFTLNFTINNLLCTADMGWPGSQKFKATERVLQRLLSPLLENSSLGSD
YSGCRLTMLRPVQNGTATKFLCGHWKTPTTPSLDRKKIYWELSNQTQGITRLGAYTLDNK
SLYLDG
Download sequence
Identical sequences F6R0T6
ENSMODP00000026073 13616.ENSMODP00000026073 ENSMODP00000026073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]