SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026090 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026090
Domain Number 1 Region: 45-140
Classification Level Classification E-value
Superfamily Immunoglobulin 5.94e-17
Family V set domains (antibody variable domain-like) 0.0076
Further Details:      
 
Domain Number 2 Region: 148-238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000483
Family I set domains 0.003
Further Details:      
 
Domain Number 3 Region: 254-326
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000677
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026090   Gene: ENSMODG00000020863   Transcript: ENSMODT00000026555
Sequence length 343
Comment pep:novel chromosome:BROADO5:4:370635256:370640062:1 gene:ENSMODG00000020863 transcript:ENSMODT00000026555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQLGLPPTGAPGPWKGLLLTAVFLMAWIPPAPALLNILVIPEPPAQGDNVTLLVRGLPG
ELLAYNWYRGTNLNQAHLILSYIISTADETPGPAYTGREAVRPDGSLNLRDVVPEDSGSY
ILQTLNKQFQTDIAYGHLLVHGEKILSPPLLLANGTELVERRDTIHLLCSTPSTGDVRWF
FNGEALPIGSRLGLTPDNRILVRHNVRREEAGAYQCEISNPVSVSRSDPVNLTVYYGPDR
VTIIQESASQTGCTVKVELDASLTLWCVTRSCPDPEYIWSFNGRTHESTTSFVNITGMTK
DKEGTYTCIAKNPITELTGSASVLVKMLGESPWPQCPLHLSGT
Download sequence
Identical sequences F6QGB2
13616.ENSMODP00000026090 ENSMODP00000026090 ENSMODP00000026090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]