SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026092 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026092
Domain Number 1 Region: 38-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000218
Family I set domains 0.07
Further Details:      
 
Domain Number 2 Region: 246-340
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000049
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 172-248
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000136
Family C1 set domains (antibody constant domain-like) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026092   Gene: ENSMODG00000020865   Transcript: ENSMODT00000026557
Sequence length 381
Comment pep:novel chromosome:BROADO5:4:370594335:370604921:1 gene:ENSMODG00000020865 transcript:ENSMODT00000026557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCPDKCQSEPLTYFSSLFSPTPPTSCSAPQSIHVKMLAVVHGLLGKDVQLPCHLVPKGVE
VQVSQVTWLRQNQTSGTMSIAVYHPTHGVGFPSTGPGVERLAFVSQSQDPGSEFHNATLL
IRDLRGEDEANYTCEFATFPGGNGKGTTLLRVLAEPKSHAESYEVASGPDPVTMASCVSS
GGRPPARISWSSLLAGQSHETRTAEPGSDTFTVTSHLTQVPMARANGEKAICKVEHETLR
EPALLSVTLAVRYCPEVSISSHDDDWYVGRTEASLNCDAQSNPEPTSYNWSTISGSLPST
AVSQGAMLIFHPVDWSVNTTFICQVTNALGTGWANRTIHVKGEGPGKSASLSTGQVVAIV
VGVISVLSILGVFLWKRKSLC
Download sequence
Identical sequences F6QG96
13616.ENSMODP00000026092 ENSMODP00000026092 ENSMODP00000026092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]