SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026094 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026094
Domain Number 1 Region: 197-280
Classification Level Classification E-value
Superfamily Immunoglobulin 2e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 15-95
Classification Level Classification E-value
Superfamily Immunoglobulin 7.71e-16
Family I set domains 0.0027
Further Details:      
 
Domain Number 3 Region: 108-181
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000511
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 297-363
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000446
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026094   Gene: ENSMODG00000020867   Transcript: ENSMODT00000026559
Sequence length 429
Comment pep:novel chromosome:BROADO5:4:370524068:370570073:1 gene:ENSMODG00000020867 transcript:ENSMODT00000026559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKPRITANTTSITEAKGSVAFRCLTKDKGITILWFLNNQAIPQSKRLLLSNDNKTLTL
LETRREDAGQYQCEVWNQLGAQSSDHITLTIYYGPNSISKTSSPTYFRDTVEAKLGSRVN
LECRATSMPSCRYQWHLNGTALPTNNSNISIKNLSWSDVGTYRCIAENPGTQVVLYDTFI
LKVADSISKPKISANTTVPVAEIDSVVFTCHTNATNVKILWFNGGVLLSGGERLQLSSDN
RTLTILRVTLGDQGLYYCRVENNLTSATSDTIQLTVNYSPSQIFLFTHPTRSYENVITSD
LNYSVVLNCEVSGSPSPLVFWFFNGTECWNRSVYVIQRLSPKDLGNYFCMARNSVGQQTS
PSIQVRLPQDNSDIEPIEPDPIYSLSGAPAICLTVAGIAGIIFFIGGMTYSVLNRKSVRK
GKSQECGCI
Download sequence
Identical sequences F6QG81
ENSMODP00000026094 ENSMODP00000026094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]