SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026113 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026113
Domain Number 1 Region: 2151-2235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000241
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 91-172
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000392
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 2247-2317
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000126
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 968-1051
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000191
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 1943-2034
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000031
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 2037-2117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000488
Family I set domains 0.024
Further Details:      
 
Domain Number 7 Region: 799-877
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000156
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 440-520
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000214
Family I set domains 0.023
Further Details:      
 
Domain Number 9 Region: 1326-1408
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000219
Family I set domains 0.071
Further Details:      
 
Domain Number 10 Region: 616-697
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000284
Family I set domains 0.019
Further Details:      
 
Domain Number 11 Region: 1144-1227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000303
Family I set domains 0.025
Further Details:      
 
Domain Number 12 Region: 1656-1760
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000639
Family I set domains 0.025
Further Details:      
 
Domain Number 13 Region: 1504-1584
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000701
Family I set domains 0.024
Further Details:      
 
Domain Number 14 Region: 285-349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000371
Family I set domains 0.02
Further Details:      
 
Domain Number 15 Region: 1832-1934
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000381
Family I set domains 0.025
Further Details:      
 
Domain Number 16 Region: 1596-1682
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000612
Family I set domains 0.01
Further Details:      
 
Domain Number 17 Region: 1770-1856
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000656
Family I set domains 0.043
Further Details:      
 
Domain Number 18 Region: 155-266
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000141
Family I set domains 0.013
Further Details:      
 
Domain Number 19 Region: 1035-1146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000153
Family I set domains 0.011
Further Details:      
 
Domain Number 20 Region: 1418-1506
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000153
Family I set domains 0.01
Further Details:      
 
Domain Number 21 Region: 362-450
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000433
Family I set domains 0.01
Further Details:      
 
Domain Number 22 Region: 1242-1330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000114
Family I set domains 0.014
Further Details:      
 
Domain Number 23 Region: 711-802
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000126
Family I set domains 0.0082
Further Details:      
 
Domain Number 24 Region: 539-626
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000462
Family I set domains 0.023
Further Details:      
 
Domain Number 25 Region: 13-98
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000695
Family I set domains 0.02
Further Details:      
 
Domain Number 26 Region: 890-978
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000129
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026113   Gene: ENSMODG00000027637   Transcript: ENSMODT00000026578
Sequence length 2369
Comment pep:novel chromosome:BROADO5:Un:18575899:19021802:1 gene:ENSMODG00000027637 transcript:ENSMODT00000026578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYAPLSKPTILTSNNTEVETKDFSLTCNATGQIHTYKWFINGVAPAGRRIQLSPDRRTL
TLRSLTRSVNKGPYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSANEYPTGANITLSC
VADSNPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYA
PVSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFINGVAPAGSRIQLSPDKRTLTLSR
LTRRDNKGPYECEIQNPFYSNRSDPFTLDVAYGPDIATIDRISDQFATGINVTLSCVADS
NPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLSK
PTIVTSNITAVETKDFSLTCQATGQIHTYQWFINRVATAGSRIQLSPDKRTLTLSRLTRR
DNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIVHISDQFATGINVTLSCVADSNPPA
QFTWLQNGQPVSNSASFSIITSLNDIGNYTCIATNSFTGLTRTANKNLMIYAPLSKPTIL
TSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAGRRIQLSPDRRTLTLSSLTRSINKG
PYVCEIENPFYRNRSDPFTLDVAYGPDIATIDRISDQFSTGNNVTLSCVADSNPPAQFTW
LQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANKTLMIYAPLPKPTIVTSNN
TAVETKDFSMTCKAKGQIHTYRWLINGLAPGGNRIQLSQDKRILTIRSLTRRENKGPYVC
EIENPFFMDSSDPFKLNVTYGPDNATIVHTVNEYPVGANITLTCYANSNPAAQFTWLQNG
QSVSNSATFSFIATLNHAGTYTCIASNSFTGLTRTATKNLIIYAPLSKPTILTSNITAVE
TKDFSFTCQGIGQIHAYWWLINGVAPAGGRIQLSPDKRTLTIRSLTRRENKGPYMCGIEN
PMFSNRSDPFTLDVAYGPDIATIVHTPDVYPTGANITLSCSATSNPPVQFTWLQNGQPVS
NSATFSFIASLNHAGTYTCTASNSFTGLTRNATKNLIIYAPLSKPTIVTSNITAVETKDF
SMTCQATGQIHAYRWFINGVAPAGSRIQLSPDKKILTIPNLTRRDNKGPYVCEIENPLFS
NRSDPFTLDVAYGPDIAMIVRTQDVYPTGANITLSCSAISNPPVQFTWLQNGQPVSNSAT
FSFIASLNRAGTYTCIASNSFTGLACTANKTLIIYAPLSKPTILTSNRTAVETKDFSLTC
QATGQIHAYRWFINGLAPSGSRIQLSPDKKILTIGNLTRRENKGPYVCEIENPLFRNRSD
PFTLNVTYGPDIATIAHSVDEYPIGANITLSCSAVSNPPVQFTWLHNGQPVSNSATFSFI
ASMTLSGTYTCNAANSLTGLTRSATKNVIIYAPLSKPTIVTSNITAVETKDFSFTCQATG
QIHTYRWFINGLAPSGSRIQLSPDKRTLTIRNLIRMENKGPYECEIQNPFYSNRSDPFTL
DVAYGPDTATIVRTVDEYPIGANITLSCSSKSNPPVQFTWLHNGQPVSNSATFSFTASLS
LAGTYTCSAANSFTGLTRTATKNVIIYAPLSTPIIVTSNNTAVETKDFSFTCQATGQIHT
YRWFINGLAPAGSRIQLSPDKSTLTIRRLTRRENKGPYVCEVKNPFYSNRSDPFTLDVTY
GPDTATIVHTVDEYPIGANITLSCSATSNPPVQFTWLQNGQPVSNSATFSFIASLSLAGT
YTCSAANSFTGLTRTATKNVIIYAPLSKPTISTSNIAPVENKDFSMTCQATGQNHTYRWF
INQSAPSGSRLQLSPDKRTFTIRSVTRRENKGPYVCEIKNPFYSNRSDPLTLNVTYGPDT
PVIVPTIDAYPIGANITLLCSAVSNPPAQFNWLYNGQQVSNSATFSTITFLSQSGTYTCH
ASNSFTGLQATKDMNITIYGPLSRPIINSPNRIPVENIDTVSLTCNATGQVRTYQWFINN
RAPTDNRIQLTRDKRTLTVGSLTREHEGSYVCEIKNPFYSNRSDPFTLNVYYGPDNATIL
PKVDRYPVGTNITLSCSAKSKPPAKFIWFHKGKKWRPSAKLSLTNVSLKHAGTYICQAFN
SHTGLNSTKDKNLTIYVEEKNFTDSEEKNVKINAEFTMYGNLLSPSKINNTGFVIENGTA
ILTCNTEGYGLPDVWWYYKNKRMVLNERMTLSNFYQTLTITPAKREDSGAYRCEIWDPFL
VYRSPLFNLVVCYGPEKIKIFPNSVNGQIEVTLKENLTLGCQATSEPPAQYTWQINGSSI
AENSGNNYTIYRASWDHAGTYTCIAINDVVNATISKNIRVRVIEKEAHTLSGGAIIGLVI
GFLAVVVLIGALVYFLFIRTSSGPQYFYQ
Download sequence
Identical sequences H9H7P6
ENSMODP00000026113 ENSMODP00000026113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]