SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026212 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026212
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily Immunoglobulin 4.83e-22
Family V set domains (antibody variable domain-like) 0.0000194
Further Details:      
 
Domain Number 2 Region: 124-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000427
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026212   Gene: ENSMODG00000020956   Transcript: ENSMODT00000026678
Sequence length 352
Comment pep:novel chromosome:BROADO5:4:1142672:1163761:1 gene:ENSMODG00000020956 transcript:ENSMODT00000026678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGIARGVIITSTEEKFEKAKGETVHLPCKYTLDSTDEKALNIEWTISPGDIKKEDQEIIL
YSNGQVYDHYSKDMKGRVYFTSSDPSLGDASINVTNLQLSDMGTYQCKVKKLPGIANKKM
QLSVLVKPSGTRCFIDGSSEIGSDFKLRCESAEGSLPLHYEWQKLPPTDKFPSVPSAELT
SPVISVRNATPEHSGTYSCSVKNRVGVDQCLLRVNVVPPSNTAGTIAGAVIGTFCALLLL
GLLIFCCCKKRKEEKYEKEVHHDIREDVPPPKSRTSTARSYMGSNHSSLGSMSPSNLEGY
SKAQYNQVPSEDLDRAPQSPSFPAAKVAASNLSRMGAVPVMIPAQSKDGSIV
Download sequence
Identical sequences F6SNY5
13616.ENSMODP00000026212 ENSMODP00000026212 ENSMODP00000026212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]