SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026218 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026218
Domain Number 1 Region: 240-486
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.43e-87
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 143-245
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-19
Family Hepsin, N-terminal domain 0.08
Further Details:      
 
Domain Number 3 Region: 106-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026218   Gene: ENSMODG00000020961   Transcript: ENSMODT00000026685
Sequence length 489
Comment pep:novel chromosome:BROADO5:4:1688435:1755902:1 gene:ENSMODG00000020961 transcript:ENSMODT00000026685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNTGPPVFGPYYENHGYQVEHYPPEHLVNAYVPYPASYCPPAVPQYIPRVLTHTSAPA
AAHLQPKSSSGIVCTSRAKRAVCVAVSVGVIVVGAVIATVFLWKFVKNSCPNSGIECGTS
GTCISPANWCDGISHCPSGEDENHCVRLYGPKFILQIYSSHNKSWYPVCQDGWNDNYGKI
ACKDMGYNNSFYSSRGIIDDSGTTSYMKLNLSAGNVDLYEKLYNSNVCFLRTVVSLRCIK
CGTVMKVNQLNRIVGGTNAAPGEWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLS
NPRYWTAFAGILRQSVMFYGSGYKVQKIISHPSYDSNTKNNDVALIKLQTPLTFNEKIRP
VCLPNPGMMFEPTQSCWISGWGATHEKGRTSDILNAVMVPIIEPWKCNSRYVYNNMITPA
MICAGYLRGKIDSCQGDSGGPLVTEKNSVWWLVGDTSWGSGCAKANRPGVYGNLTVFTDW
IYQQMQANR
Download sequence
Identical sequences F6SNU6
ENSMODP00000026218 ENSMODP00000026218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]