SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026222 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026222
Domain Number 1 Region: 885-1088
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-43
Family Fibronectin type III 0.00000773
Further Details:      
 
Domain Number 2 Region: 1086-1284
Classification Level Classification E-value
Superfamily Fibronectin type III 2.59e-39
Family Fibronectin type III 0.0007
Further Details:      
 
Domain Number 3 Region: 1379-1558
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-32
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 688-786
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-21
Family I set domains 0.062
Further Details:      
 
Domain Number 5 Region: 1285-1384
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 224-312
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 7 Region: 407-506
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 8 Region: 593-692
Classification Level Classification E-value
Superfamily Immunoglobulin 4.37e-19
Family I set domains 0.024
Further Details:      
 
Domain Number 9 Region: 787-890
Classification Level Classification E-value
Superfamily Immunoglobulin 1.91e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 507-599
Classification Level Classification E-value
Superfamily Immunoglobulin 7.44e-17
Family I set domains 0.035
Further Details:      
 
Domain Number 11 Region: 307-400
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000021
Family I set domains 0.048
Further Details:      
 
Domain Number 12 Region: 127-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000208
Family I set domains 0.091
Further Details:      
 
Domain Number 13 Region: 35-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000147
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026222   Gene: ENSMODG00000020965   Transcript: ENSMODT00000026689
Sequence length 2007
Comment pep:novel chromosome:BROADO5:4:2102662:2943704:1 gene:ENSMODG00000020965 transcript:ENSMODT00000026689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWILAFSLFQSILNVFSEDLHSSLYFVNASLQEVVFASTTGTLVPCPAAGIPPVTLRWYL
ATGEEIYDVPGIRHVHLNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKA
VLREPYTVRVEDQKTMRGNVAVFKCIISSSVEAYITVVSWEKDTVSLVSGSRFFITSTGA
LYIKDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSVLDGFDHRKAMAGQ
RVELPCKAFGHPEPNYHWLKDNMPLEVVGRFQKTVTGLLIENSRPSDSGSYVCEVSNRYG
TAKVIGHLHVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEEQELSWYRNGEILKPGKNV
RITGINHEKLIMDHMVKSDGGAYQCFVRKDKMSAQDYVQVVLEDGTPKIISAFSEKVVSP
GEPVSLMCNVKGTPLPTITWTLDDDPILKGGSHRVSQIITSEGNVVSYLNISNTQVRDGG
VYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGWDTYIHCRVIGYPYYSIKWYKN
SNLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQ
PFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPASLGVTIDNIDFTSSLRISNLS
LMHNGNYTCIARNDAAAVEHQSQLIVRVPPKFVVQPSDQDGIYGKAVILNCSAEGYPVPT
IVWKFSKGAGVPQFQAIVLNGRIQVLTNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSM
YLTVKIPAMITSYPNTTLATQGQKKEMICTAHGEKPIIVRWEKEDRIINPEMARYLVSTK
EVGEEVLSTLQILPTLREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDVRART
ITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRM
YAKNRIGKSEASNELTITADEAAPDGPPQEVQLEPISSQSIRVTWKAPKKHLQNGIIRGY
QIGYREYSTGGNFQFNIISIDTTGDSEIYTLDNLNKFTQYGLVVQACNRAGTGPSSQEII
TTTLEDVPSYPPENVQAIATSPETISITWSTLAKEALNGILQGFRVIYWANLLDGELGEI
KNVTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAA
SASTVFVSWLPPFKLNGIIRKYTVFCSHPYPTVNSEFEASPDAFSYRIPNLNRNQQYSVW
VVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPTVKWM
KDSNGMPSLVMVDGRRSIFSNGSFVIRTVKAEDSGYYSCVANNNWGSDEIILNLQVQVPP
DQPRLTVSKTTSSSITLSWIPGDNGGSSIRGYILQYSEDNSEQWGSFPISPSERSYRLES
LKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWN
DGGCPITSFILEYRPFGTTVWTTAQRTSLSKSYILYDLQEATWYELQMRVCNSAGCAEKQ
AKFATLNFDGSTIPPLIKSVVQSEEGLATNEGLKMLVTISCILVGVLLLFVLLLIVRRRR
REQRLKRLRDAKSLAEMLMSKNTRTSDTLNKQQTLRMHIDIPRAQLLIEERDTMETIDDR
STVLLTDADFGEASKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKGGPT
TRNRYASQWTLNRPHPTISAHTLTTDWRLPTPRVTGSVDKESDSYSVSPSQDTDRARSSM
VSTESASSTYEELARAYEHAKMEEQLRHAKFTITECFISDTSSEQLTAGTNEYTDSLTSS
TPSESGICRFTASPPKPQDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPSISRD
QNLGQACLEPQKSRTLKCSTVLEPIPMETPSTREVQPWQPGAVAPLPQREGAELGQAAKI
SSSQESLLDSRGHLKGNNPYAKSYTLV
Download sequence
Identical sequences F6SNE0
ENSMODP00000026222 ENSMODP00000026222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]