SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026256 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026256
Domain Number 1 Region: 494-678
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-33
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 2 Region: 201-300
Classification Level Classification E-value
Superfamily Immunoglobulin 2.35e-21
Family I set domains 0.0021
Further Details:      
 
Domain Number 3 Region: 298-404
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 394-490
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 115-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000275
Family I set domains 0.0012
Further Details:      
 
Domain Number 6 Region: 22-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000577
Family I set domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026256   Gene: ENSMODG00000020992   Transcript: ENSMODT00000026723
Sequence length 834
Comment pep:novel chromosome:BROADO5:4:5597812:5845865:1 gene:ENSMODG00000020992 transcript:ENSMODT00000026723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLFFAFYLLGLFVSHGQALLQVTISLSKVEISVGESKFFTCTAIGELEDIDWYNPQGEK
IVSSQRVVVQKEGARSRLTIYNANIEDAGIYRCQGTDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCQVSSSPAPIVSWLYHNEEVATHSNNRFAMLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAITMPLIFFNATADRQEDMIFSCRATGSPEP
NISWYRNGKLIEDNEKYTLKRNNTELTVRNIINSDGGSYVCRATNMAGKDEKQSFLQVFV
QPHIIQLKNETTFENGQITLICEAEGEPIPEITWKRALDGTTFSEGGKSPDGHVEVRGRR
GRSSLHIKEVKLSDSGRYDCEAASTIGGHQKSMYLDIEYAPKFVSNQTIYYSWEGNPINI
SCDVRANPPASILWSRDKLFLPSRNVTHLKTFSSGRKMTLEIAPTSDSDFGRYNCTATNR
IGTRFQEYILALADVPSSPSEVRIIELSQTIAKVSFNKPDSHGGVPIHHYQLDVKEVASE
TWKVFRSHGTSTTVVLSNLEPNTTYEIKVAAVNGKGQGEYSKIEIFQTLPVREPSPPSIH
GQPSNGKSFKLSIMKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIVLEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKGEHTYGFVIMCLFIVFSGFSSIKTIMFS
CLSINYFSLEYLHVSLLSGLTEEGNSYLGKLEILFLGLRKDGSKEPIVEMRTEDERITSH
EDGSPINEPNETTPLTEPEKLPLKEENEKEVLNPEIIEAKISIDTTQSKEDSKA
Download sequence
Identical sequences F6RKM8
ENSMODP00000026256 ENSMODP00000026256 13616.ENSMODP00000026256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]