SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026280 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026280
Domain Number 1 Region: 127-225
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-16
Family I set domains 0.0028
Further Details:      
 
Domain Number 2 Region: 36-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000198
Family V set domains (antibody variable domain-like) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026280   Gene: ENSMODG00000021012   Transcript: ENSMODT00000026748
Sequence length 297
Comment pep:novel chromosome:BROADO5:4:7564121:7676079:-1 gene:ENSMODG00000021012 transcript:ENSMODT00000026748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSCHRFVLLLLSYLGVVLGYHNAYGFSTPRNHQVVTAIEFQEAILSCKYQKKTSPSR
LEWKKLGPSVSFVYYQQAFQGDFKDRAEMLNFSIRIKNVTRNDAGQYRCEVSVPSDQGQN
LEEDIITLEVLVAPGVPVCEVPSSALSGTVVELKCQDKQGFPAPEYTWFKNGVHLLENPK
SGHKITNMSYTMNRKTGTLQFNSVSKLDTGEYFCEARNSVGHHKCPGKQMQVDDLNINGI
LGAVITVALLILLCGLGACYAQKKGYFAKENSFQKDNSDPKAAMGECDFKHTKSFVI
Download sequence
Identical sequences F6QZG9
ENSMODP00000026280 XP_016288625.1.35504 ENSMODP00000026280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]