SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026342 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026342
Domain Number 1 Region: 126-235
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-21
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 2 Region: 39-146
Classification Level Classification E-value
Superfamily Fibronectin type III 6.28e-17
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026342   Gene: ENSMODG00000021066   Transcript: ENSMODT00000026811
Sequence length 344
Comment pep:novel chromosome:BROADO5:4:14326433:14355573:-1 gene:ENSMODG00000021066 transcript:ENSMODT00000026811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSRGSGACWAASLQLHILLCYCCCLSFTLALAGPRTQLPVPQNQRIHLYNLEQVLSWDP
VPISNLKSPVLYSVEYHYTTNNWMKETHCTRIAEPVCNFTAANQPHFQPHFNVTLRVRAE
RGALVSDWVVMPWFQQYLNATIGPPLDVVVTPLNDSLGIRFKPPFNVDSGKFKYYVHYWK
DEGKPMVQGPFPDSAIHLKDFDSPGNYCLQVQAELTANYVKPPRRGLLSPISCHKIYAKA
LTKVQQTLIIISVFFTSLFFLVLGCYFVAQKFQGPIKHVFQSPPGIPPQIKEYLSDPDEP
ILEALDKKSSPEDRWDSLSVVISCPEEDQTIQCHLSTIIQITPN
Download sequence
Identical sequences F6V1Z4
ENSMODP00000026342 ENSMODP00000026342 XP_007493328.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]