SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026343 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026343
Domain Number 1 Region: 116-229
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-29
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 321-434
Classification Level Classification E-value
Superfamily Fibronectin type III 7.6e-26
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 3 Region: 235-345
Classification Level Classification E-value
Superfamily Fibronectin type III 1.45e-23
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 4 Region: 32-140
Classification Level Classification E-value
Superfamily Fibronectin type III 8.67e-18
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026343   Gene: ENSMODG00000021067   Transcript: ENSMODT00000026812
Sequence length 565
Comment pep:novel chromosome:BROADO5:4:14420849:14470407:-1 gene:ENSMODG00000021067 transcript:ENSMODT00000026812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSITPAAVLVLLVASAELSLFPIAAGEKNLKTPQNVTVEIVDHNFILKWNWDNEPNSNT
TFSAYYQKVKSGNMNNWVELIGCHKVTGTKCDFTSTNLNVFEKIKVRIRSEKGQETSPWY
DITPFVPFQIAQIGPPEVQLEAEDKSIIINISPPGTSNSNMWATDNQRFTYSLVIWKNSS
SIKETHHTVYSRDKINDLTPETTYCLKVQARLPILRKNGSYSPVFCINTTAEHKLPRPEN
VEVDAVNNNYVLKWNYPYENMNFEVQYLLGFYKRILSDYSDKWKVISGCKNITSKHCDFS
KDITTDGIYYLRVQASNGSITSFWSTEKKFDTMIKTNIAPPSIKVIPSGDSFSIYISAPE
ESEKKLMSQNYPLIYEVIYWENNSNIENKLRVKQKLLKVSDLQPLTTYCFKAKAFLQDNK
SNKSSQFSDVVCSKMTPGKLAVSWIIVICIVCLMMLVLVFYCSKVLLKQVKHIFSPSWKP
PSSMSERFSDQPLKNLLVASEEQTESCIIEETNIVMLEETDQNGKSDVICSKQDNQDSGN
FSNKDETSSSSKVTEEALQLETMPQ
Download sequence
Identical sequences F6V1Y4
ENSMODP00000026343 ENSMODP00000026343 XP_007493331.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]